KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033312
Entry
101033312         CDS       T04350                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101033312 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101033312 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101033312 (CNTF)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101033312 (CNTF)
SSDB
Motif
Pfam: CNTF DUF3719
Other DBs
NCBI-GeneID: 101033312
NCBI-ProteinID: XP_003920206
UniProt: A0A2K6UNY5
LinkDB
Position
Unknown
AA seq 200 aa
MAFAEHSPLTPHRRDLCSRSIWLARKIRSDLAALTESYVKHQGLNKNINLDSVDGVPMAS
TDQWSELTEAERLQENLQAYRVFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA
YQIEELMVLLEYKIPPSEADGMPVGVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHQTGIPARGSHYIAKEKKM
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcttttgcagagcattcaccactgacccctcaccgtcgggacctctgtagccgctct
atctggctagcaaggaagattcgttcagacctggctgctcttacggaatcttatgtgaag
catcagggcctgaacaagaacatcaacctggactctgtggatggggtgccaatggcaagc
actgatcagtggagtgagctgaccgaggcagagcgactccaagagaatcttcaagcttat
cgtgtcttccatgttttgttggccaggcttttagaagaccagcaggtgcattttacccca
actgaaggtgacttccatcaagcaatacatacccttcttctccaagttgctgcctttgct
taccagatagaggagttaatggtactcctggaatacaagattccccccagtgaggctgat
gggatgcctgttggtgttggagatggtggtctctttgagaagaagctttggggtctaaag
gtgctacaggagctttcacagtggacagtgaggtctatccatgaccttcgtgtcatatct
tctcatcagactgggatcccagcacgtgggagccattatattgctaaggagaagaaaatg
tag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037800
Entry
101037800         CDS       T04350                                 

Gene name
PRL
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101037800 (PRL)
   04151 PI3K-Akt signaling pathway
    101037800 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101037800 (PRL)
   04060 Cytokine-cytokine receptor interaction
    101037800 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101037800 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101037800 (PRL)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101037800 (PRL)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 101037800
NCBI-ProteinID: XP_003927357
UniProt: A0A2K6T901
LinkDB
Position
Unknown
AA seq 227 aa
MNIKGSPWKGSLLLLLVSNLLLCQSVTSLPVCPGGAVRCQVTLRDLFDRAIVLSHYIHNL
SSEMFSEFDKQYTQGRGFISKAINSCHTSSLATPEDKEQAQQISQKDFLSLIISILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELILSQVHPETKGNEVYSVWSG
LPSLQMADEESRLFAYYNLLHCLRRDSHKIDNYLKLLKCRIVHDNNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaacatcaaaggatcgccatggaaagggtccctcctgctgctgctggtatcaaacctg
cttctgtgccagagcgtgacctccttgcccgtctgtcctggcggggctgtcagatgccag
gtgacccttcgagacctctttgaccgtgccatcgtcctgtcccactacatccataacctc
tcctcagaaatgttcagcgaattcgataaacagtatacccaaggccgggggttcattagc
aaggccatcaacagctgtcacacttcttccctcgctacccctgaagacaaggagcaagcc
cagcagatcagccaaaaagacttcctcagcctgataatcagcatactgcgatcctggaat
gagcctctgtaccatctagtcacggaagtacgcggtatgcaagaagccccggaggccatc
ctatccaaagccgtagagattgaggagcaaaccaaacggcttctagagggcatggagctg
atactcagccaggttcatcctgaaaccaaaggaaatgaggtctactctgtctggtcggga
cttccatccctgcagatggctgatgaagagtctcgcctttttgcttattataaccttctc
cactgcctacgcagggattcacataagatcgacaattatctcaagctcctgaagtgccga
atcgtccatgacaacaactgctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101039453
Entry
101039453         CDS       T04350                                 

Definition
(RefSeq) somatotropin-like isoform X1
  KO
K05438  growth hormone
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101039453
   04151 PI3K-Akt signaling pathway
    101039453
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101039453
   04060 Cytokine-cytokine receptor interaction
    101039453
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101039453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101039453
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101039453
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 101039453
NCBI-ProteinID: XP_010328557
LinkDB
Position
Unknown
AA seq 230 aa
MGSACGLCLFPGFLLGGSRTSLLLAFTLLCLPQLKEAGAFPTIPLSRLLDNAMLRAHRLH
QLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPASKKETQQKSNLELLRISLI
LIQSWFEPVQLLRSVFANSLLYGVSDSDVYEYLKDLEEGIQTLMERLEDGSPRTGAIFRQ
TYSKFDINSQNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGL
NT seq 693 nt   +upstreamnt  +downstreamnt
atgggaagtgcgtgtggtctgtgtctgttcccaggatttctgctgggtggctcccggaca
tccctgctcctggctttcaccctgctctgcttgccccagcttaaagaggctggtgccttc
ccaacaattcccttatccaggcttttggacaatgctatgctccgcgcccatcgcctgcac
cagctggcctttgacacctaccaggaattcgaagaagcctatatcccgaaggaacagaag
tattccttcctgcagaacccccagacctccctctgcttctcagagtctatcccgacacca
gccagcaaaaaggaaactcagcagaaatccaacctagagctgctccgcatctccctgatc
ctcatccagtcctggttcgagccagtacagctcctcaggagtgtcttcgccaacagccta
ttgtatggcgtctcagacagcgatgtctatgagtacctgaaggacctagaggaaggcatc
caaactctaatggagaggctggaagacggcagcccccggactggggcgatcttcaggcag
acctacagcaagtttgacatcaactcgcagaacgatgacgcactgctcaagaactacggg
ctgctctactgcttccggaaggacatggacaaggtcgagacgttcctgcgcattgtgcag
tgccgctctgtagagggcagctgtggcctctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040223
Entry
101040223         CDS       T04350                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor isoform X2
  KO
K05423  granulocyte colony-stimulating factor
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04657  IL-17 signaling pathway
sbq05144  Malaria
sbq05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101040223 (CSF3)
   04151 PI3K-Akt signaling pathway
    101040223 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101040223 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101040223 (CSF3)
   04657 IL-17 signaling pathway
    101040223 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101040223 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    101040223 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101040223 (CSF3)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101040223 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6
Other DBs
NCBI-GeneID: 101040223
NCBI-ProteinID: XP_003942881
LinkDB
Position
Unknown
AA seq 204 aa
MAGPAAQSPMKLVALQLLLWHSALWTAQEATPLGPASSLPQSFLLKCLEQARKVQGDGTE
LQEKLCATYKMCHLEEMVLFRHSLGIPQVSLSSCSSQALQLTGCLRQLHSGLFLYQGLLQ
TLEGISPELAPTLDMLRLDIADFATTIWQQMEELGTAPALQPTRGATPALPSAFQRRVGG
LLVASHLQSFLELVHRVLRHLAQP
NT seq 615 nt   +upstreamnt  +downstreamnt
atggctggacctgccgcccagagccccatgaagctggtggccctgcagctgctgctatgg
cacagtgcactctggacagcgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagcgaggaaggtccagggcgatggcacggag
ctgcaggagaagctgtgtgccacctacaagatgtgccacctcgaggagatggtgctgttc
aggcactctctgggcatcccccaggtttccctgagcagctgctccagccaggccctacag
ctgacaggctgcttgaggcagctccatagcggcctcttcctctaccagggcctcctgcag
accctggaagggatctcccccgagttggcccccaccttggacatgctgcgcctggacatc
gctgactttgccaccaccatctggcagcagatggaagagctgggaacagcccctgccctg
cagcccacccgtggcgccacaccagccttgccctctgccttccagcgccgggtgggaggc
ctcctggtggcctcccatctgcagagcttcctggagctggtgcaccgcgttctacgccac
cttgcccagccctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041089
Entry
101041089         CDS       T04350                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101041089
   04151 PI3K-Akt signaling pathway
    101041089
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101041089
   04060 Cytokine-cytokine receptor interaction
    101041089
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101041089
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101041089
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101041089
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 101041089
NCBI-ProteinID: XP_010328606
LinkDB
Position
Unknown
AA seq 217 aa
MAASFRMSLLLALALLCPPWFQETGAFPRIPLSRLFSDAMLRAHQLHHLGFDTYHEFEEN
NIPKEQKYFFLRKPRTSLCFSESIPTPSNREEMLAKSKLELLHICLLLIQSWLEPMQLLG
SVFANSQLHNVLSTDVYEYLKDLEEGIQTLMERLEDGSPRTGEIFTQTYSKFDRNSQSDD
PLLNNYMMLFCFRKDMNKVETFLHVVQCRSVEGSCGL
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaagcttccggatgtctctgctcctggctcttgccctgctctgcccgccctgg
tttcaagagactggtgcctttccaagaattcccttatccaggctttttagcgacgctatg
ctccgtgcccatcagctgcaccacctgggttttgacacctaccacgagtttgaagaaaat
aatatcccgaaggaacagaagtatttcttcctgcgtaagcccaggacctccctctgcttc
tcagagtctatcccaacaccctccaacagagaggaaatgctggcaaaatccaaactagag
ctgctgcacatctgcctcctcctcatccagtcctggctggaacccatgcagctcctcggc
agtgtctttgccaacagccaactgcataacgtcttgagcaccgatgtctatgagtacctg
aaggacctagaggaaggcatccaaactctgatggagaggctggaagatggcagcccccgg
actggggagatcttcacgcagacctacagcaagtttgacagaaactcgcaaagcgatgac
ccactgctcaataactacatgatgctcttctgcttccggaaggacatgaacaaggtggag
acgttcctgcacgttgtgcagtgccgctctgtggagggcagctgtggcctctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047352
Entry
101047352         CDS       T04350                                 

Gene name
THPO
Definition
(RefSeq) LOW QUALITY PROTEIN: thrombopoietin
  KO
K06854  thrombopoietin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101047352 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101047352 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101047352 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101047352 (THPO)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101047352 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 101047352
NCBI-ProteinID: XP_010335964
LinkDB
Position
Unknown
AA seq 493 aa
MDPPIQTFSVVYVGGGVDPGPGKGPSEEKASLPGAFASVWWLPPLIGQRWPRQACDLLRW
RGCTPPPHXLLPICSPECGLLCTWVLEPLSTWIESSSSAHIRPTLLCPEVXESKPPPWPQ
EGFGGEAPNREPCQPDTLARMELTELLFVLMLLLTARLTLSSPAPPACDPRVLSKLLRDS
RVLHSRLSQCPDVSPLPTPVLLPTVDFSLGEWKTQTEQTKAQDILGAVTLLLEGVLAARG
QLGPTCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPNDIFLSFQHLLRGKV
RFLLFVGRPTLCXRRAPPTTAVPSRTSPVLTLNELPHRTSGLLETNFTASARTTGSGLLK
QQPGFRARIPGLLNXTSXSLGQIPRYLNRTHQLLNGTRGLFPGPSRRTLGALDLSPRTSD
TGSLPPNLQPRFSPSLTHPTTGQHTFFPLSPTLPTPVTQLHPLLPDPSAPMPAPTSPILN
TFHTHSRNLSQEG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggatccccctatccagaccttctctgtggtgtatgtgggtggaggagtggaccctggt
ccaggcaagggccccagcgaagagaaggcgtcacttccgggggccttcgccagtgtctgg
tggctccctcctctgattgggcagaggtggcccaggcaggcgtgtgacctgctgcgttgg
aggggctgtaccccaccgccacatnncctcctacccatctgctccccagagtgcggccta
ctgtgcacctgggtccttgagcccctctccacctggatagagtcctcttcctcggcccac
attcgccccaccctactctgcccagaagtgtaagagtccaagccgcctccatggccccag
gaaggatttgggggagaggccccaaacagggagccatgccagccagacaccctggccaga
atggagctgactgaactgctcttcgtgctcatgcttctcctaactgcaaggctaactctg
tccagcccggctcctcccgcctgtgacccccgagtcctcagtaaactgcttcgtgactcc
cgtgtccttcacagcagactgagccagtgcccagacgttagccctttgcccacacctgtc
ctgctgcctactgtggactttagcttgggagagtggaaaacccagacagagcagaccaag
gcacaggacattctgggagctgtgaccctcctgctggagggagtgctggcagcacgggga
caactaggacccacttgcctctcatccctcctggggcagctttccggacaggtccgtctc
ctccttggggccctccagggcctccttggaacccagcttcctccacagggaaggaccaca
gctcacaaggatcccaatgacatcttcctgagcttccaacacctgctccgaggaaaggtg
cgtttcctgctgtttgtaggacggcccactctctgtngcaggcgggccccacccaccaca
gctgtcccaagcagaacctctccggtcctcacactgaacgagctcccacacaggacttct
ggattgttggagacaaacttcactgcctcggccagaactactggctctgggctcctgaag
cagcagccgggattcagagccaggattcctggtctgctgaactaaacttccnagtccctg
ggccaaatccccaggtacctgaacaggacacaccagctcttgaatggaactcgtggactc
tttcctggaccctcacgcaggaccctgggagccctggacctttccccaagaacatcagat
acaggctccctgccacccaacctccagcctagattttctccttccctaacccatcccact
actgggcagcacacattcttccctctttcacccaccttgcccacccctgtgacccagctc
caccccctgcttcctgacccttctgctcctatgcccgcccctaccagccctattctaaac
acattccacacccactcccggaatctgtctcaggaagggtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101048464
Entry
101048464         CDS       T04350                                 

Gene name
LEP
Definition
(RefSeq) leptin isoform X1
  KO
K05424  leptin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04152  AMPK signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101048464 (LEP)
   04152 AMPK signaling pathway
    101048464 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101048464 (LEP)
   04060 Cytokine-cytokine receptor interaction
    101048464 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101048464 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101048464 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101048464 (LEP)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101048464 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 101048464
NCBI-ProteinID: XP_003921065
UniProt: A0A2K6S6C7
LinkDB
Position
Unknown
AA seq 167 aa
MRWGFLCQFLWLWACLSCTQAVPIQRVQDDTKTLIKTIITRINNLSHTQSVSPKQRITGL
DFIPEFHSDLSFSKMDEILAIYQQIVLSLPSGNMIQISNDLENLRALLHLLAASKSCHLP
WASGLETLANLGGVLEASLYSTEVVALSRLQGSLQDMLQQLDLGPAC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcgttggggattcctgtgtcaatttctgtggctttgggcctgtctgtcctgcacccaa
gctgtgcccatccaaagagttcaagatgacaccaaaaccctcatcaagacaattatcacc
cggatcaataatctgtcacatacgcagtcggtctcccccaaacaaaggatcaccggtttg
gacttcattcccgagttccactctgacctgagcttttccaagatggacgagatactggcg
atctaccaacagattgtcctcagtctgccttccggaaacatgatccaaatatccaacgac
ctggagaacctccgggcccttcttcacctgctggccgcctctaagagctgccacttgccc
tgggccagtggtctggagaccttggcaaacctggggggtgtcctggaagcttcgctctac
tccacggaggtggtggctctgagcaggctgcaggggtctctgcaggacatgctgcagcag
ctggacctcgggcctgcatgctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101049694
Entry
101049694         CDS       T04350                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04066  HIF-1 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101049694 (EPO)
   04066 HIF-1 signaling pathway
    101049694 (EPO)
   04151 PI3K-Akt signaling pathway
    101049694 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101049694 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101049694 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101049694 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101049694 (EPO)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101049694 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 101049694
NCBI-ProteinID: XP_003934220
UniProt: A0A2K6SRI2
LinkDB
Position
Unknown
AA seq 194 aa
MGARECPAWLWLLLSLLWLPLGLPVLGAPLHLICDSGVLERYALEGKEAENVTMGCAESC
SLNENITVPDTKVNFYAWKKMEFGQQAIDVWQGLTLLSDAVLRGQALLANSSQPREPLQL
HFDRAVRGLRSLTTLLRALGAQKEATTPPDAALSAVPLRTITADTFSKLFQVYSNFIRGK
LKLYAGEACRTGDR
NT seq 585 nt   +upstreamnt  +downstreamnt
atgggggcgcgcgaatgtcctgcctggctgtggcttctcctgtccctgctgtggctccct
ctgggcctcccagtcctgggtgcccccctacacctcatctgtgacagtggagtcctggag
cggtacgccttggagggcaaggaggccgagaatgtcacgatgggctgtgccgaaagctgc
agcttgaatgagaatatcaccgtcccagacaccaaagttaacttctacgcctggaagaag
atggagtttgggcagcaggctatcgacgtctggcagggtctgaccctgctctcggacgct
gtccttcggggccaggccctgttggccaactcctcccagccaagggagcccctgcagctg
cacttcgatagagctgtccgtggtcttcgcagcctcaccactctgcttcgggcgctggga
gcccagaaggaagccaccacccctccagatgcagccctctcggctgttccactccgaacc
atcactgctgacactttcagcaaactcttccaagtctactccaattttatccggggaaag
ctgaagctgtacgcaggagaggcctgcagaacaggggacaggtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053083
Entry
101053083         CDS       T04350                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101053083
   04151 PI3K-Akt signaling pathway
    101053083
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101053083
   04060 Cytokine-cytokine receptor interaction
    101053083
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101053083
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101053083
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101053083
SSDB
Motif
Pfam: Hormone_1 CLTH
Other DBs
NCBI-GeneID: 101053083
NCBI-ProteinID: XP_003942532
LinkDB
Position
Unknown
AA seq 217 aa
MAAVSRTSLLLAFTVLCLPWLPEAGALTTMPLPSLYEYAVMRAHRLNQLAFDIYQKFEDA
RSPAEQNDFYCDNPKASLCSSASDPTPANTQEAPQKSDLELLRTSLLFIQLWLNPVQSLS
SVFGNSQLNDTLNSFIYAYLKDLEEVIQTLIGKLEDGRPQIGEIFRQTYRKFDRNSQNDD
ALLKNYGLLYYFRKDMDKVKTFLRIVRCRFVKGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcagtctcccggacatctctgctcctggctttcaccgtgctctgcctaccctgg
cttccagaggccggtgccctcacaacaatgcccttaccctcactttatgagtatgctgtg
atgcgcgcccatcgcctcaaccagctggcctttgacatctaccagaagtttgaagacgct
cgtagcccggcggaacagaacgatttctactgtgataaccccaaggcctccctttgctcc
tccgcatctgatccaacacccgccaacacacaggaagctccacagaaatctgacctagag
ctgctccgcacctccctgctgttcatccagctgtggctcaatcctgtgcagtccctcagc
agtgtctttggcaacagccaactgaatgataccttaaacagcttcatctatgcgtacctg
aaggacctagaggaagtcatccaaactctgatagggaagctggaagatggcaggccccag
attggggagatcttcaggcagacctacaggaaatttgacagaaattcgcagaatgatgac
gcattgctcaagaactacgggctgctctactacttccggaaggacatggacaaggtcaag
acattcctacgaattgtgcgttgccgctttgtgaagggcagctgtggcttctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053411
Entry
101053411         CDS       T04350                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101053411
   04151 PI3K-Akt signaling pathway
    101053411
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101053411
   04060 Cytokine-cytokine receptor interaction
    101053411
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101053411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101053411
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101053411
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 101053411
NCBI-ProteinID: XP_010328632
LinkDB
Position
Unknown
AA seq 191 aa
MAAVSWTSLLLAFTVLCLPWLPEAGALPTMPLSSLYDYAVMRAHRLNQLAFDIYQKFEDA
RSPAEQNDFYCDNSKTSLCFSASDPTPANTQEAPQKSDLELLRISLLFIQLWLKPVQSLS
SVFGNSSLHDTLNSFIYEYLKDLEEVIQTQIGVRVAPGVPNSGTPLASRVGGKKHCCSLF
STQALTQENSA
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctgcagtctcctggacatctctgctcctggctttcaccgtgctctgcctaccctgg
cttccagaggctggtgccctcccaacaatgcccttatcctcactttatgactatgctgtc
atgcgcgcccatcgcctgaaccagctggcctttgacatctaccagaagtttgaagacgct
cgtagcccggcggaacagaacgatttctactgtgataactccaagacctccctttgcttc
tcagcatctgatccaacacccgctaacacacaggaagctccacagaaatctgacctagag
ctgctccgcatctccctgctgttcatccagctgtggctcaagcccgtgcagtccctcagc
agtgtctttggcaacagctcactgcatgataccttaaacagcttcatctatgagtacctg
aaggacctagaggaagtcatccaaactcagataggggtgagggtggcaccaggggtcccc
aattctgggaccccactggcttccagagttgggggaaagaaacactgctgctctcttttt
agcactcaggccctgacccaagagaactcagct

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053718
Entry
101053718         CDS       T04350                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101053718
   04151 PI3K-Akt signaling pathway
    101053718
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101053718
   04060 Cytokine-cytokine receptor interaction
    101053718
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101053718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101053718
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   101053718
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 101053718
NCBI-ProteinID: XP_003942534
LinkDB
Position
Unknown
AA seq 211 aa
TLLCLPWLGEAGALKTMPISSLYDYAVMRAHRLNQLASDIYQKFEDAHSPKEQKDFFRQN
ARTSVFFSVYVPTPTNKQETLQKSNLELLGDSLLLIQLWLKPVQSLSSAFGHSPLHSFLD
KFIYEYLKDLEEVIQTLMLRLENGSPQTGEILKHTYSIFDINLDNDDARLKNYKLLYCFR
RDMKTLAKFLRIVQCHSLEGGCVFHLTGSIP
NT seq 636 nt   +upstreamnt  +downstreamnt
accctgctctgcctgccctggcttggagaggccggtgccctcaaaacaatgccaatatcc
tcactttatgactatgctgtgatgcgcgcccatcgcctcaaccagctggcctctgacatc
taccagaagtttgaagacgctcacagcccgaaggaacagaaggatttcttccggcagaat
gccaggacatccgttttcttctcagtgtatgtcccaacacccactaataaacaggaaact
ctgcagaaatctaacctagagttgctcggcgactccctgctgctcatccagctgtggctc
aagcccgtgcagtccctcagcagtgcctttggccacagcccactgcatagtttcttagac
aagttcatctatgagtacctgaaggacctagaggaagtcatccaaactctgatgctgagg
ctggaaaatggcagcccccagactggggagatcctcaagcacacctacagcatttttgac
atcaacttggacaacgatgacgcacggctcaagaactacaagctgctctactgcttccgg
agagacatgaaaacgcttgcaaaattcctgcgcattgtgcagtgccactctttggagggc
ggctgtgtcttccatctgacaggttccatcccttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104649998
Entry
104649998         CDS       T04350                                 

Definition
(RefSeq) uncharacterized protein LOC104649998
  KO
K05438  growth hormone
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104649998
   04151 PI3K-Akt signaling pathway
    104649998
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104649998
   04060 Cytokine-cytokine receptor interaction
    104649998
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104649998
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    104649998
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   104649998
SSDB
Motif
Pfam: Hormone_1 DUF1045
Other DBs
NCBI-GeneID: 104649998
NCBI-ProteinID: XP_010328630
LinkDB
Position
Unknown
AA seq 293 aa
MRDQLQDPKAQLAKPRRVLWTAHLAAMAAVSRASLLLAFNLLCLPWLPEAGAFPTMPVSL
LYDYAVMRAHRLNQLAIDIYQKFEDARSPEEQKDFFRRKARTSVCFSSSVPTPTDKQETV
QKSNLELLRISLLLIQSGKKEEKKQERVPRLHRASCISRTSLLLAFTLLCLPWLSEAGGL
TTMPISSLYFYAVMRAHRLNQLAFDIYQKFEEARSLEEQTDFFRHNARTFVCFSASVPTP
TNRKETLQKSVGQHGMLPEGTHLPLKERPGWVVPLADTLCATLTALVTVGRER
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagagaccagctccaggatcccaaggcccagctcgccaaaccacgaagagtcctgtgg
acagctcacctagctgcaatggctgcagtctcccgggcatccctgctcctggctttcaac
ctgctctgcctgccctggcttccagaggccggtgccttcccaacaatgcccgtatccttg
ctttatgactatgctgtgatgcgtgcccatcgcctcaaccagctggccattgacatctac
cagaagtttgaagacgctcgtagcccggaggaacagaaggatttcttccggcgtaaagcc
aggacctcggtttgcttctcatcgtctgttccaacacccactgataaacaggaaactgtg
cagaagtctaacctagagctgctccgcatctccctgctgctcatccaatctggaaagaag
gaggagaaaaagcaggagcgggttccacggctgcatagggcatcctgcatctcccggaca
tctctgctcctggctttcaccctgctctgcctgccctggctttcagaggccggtggcctg
acaacaatgcccatatcctcgctttatttctatgctgtgatgcgcgcccatcgcctcaac
cagctggcctttgacatctaccagaagtttgaagaagctcgtagcctggaggaacagacg
gatttcttccggcataatgccaggaccttcgtttgcttctcagcgtctgtcccaacaccc
actaacagaaaggaaactctgcagaaatctgttggccagcatggcatgctgccagagggt
acccacctgcccctaaaagagaggccaggatgggtggtgcctctggctgacactctgtgc
gcaacccttacagcgctggtgacggtgggaagggaaagatga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104649999
Entry
104649999         CDS       T04350                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04080  Neuroactive ligand-receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104649999
   04151 PI3K-Akt signaling pathway
    104649999
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104649999
   04060 Cytokine-cytokine receptor interaction
    104649999
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104649999
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    104649999
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  CSF and other factors
   104649999
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 104649999
NCBI-ProteinID: XP_010328631
LinkDB
Position
Unknown
AA seq 165 aa
MAAVSRASLLLAFTLLCLPWLAETGVLTTMPVSWLYEYAVMRAHRVNYLAFDIYEKFEDA
RSLKEQKDFFRHKARTTVCFTTSVPSPVNKEEILQKSNLELLGDSLLSDIRPISECSWSL
RETFAEAGRWQPQTGEIFRQTYRMFDINSQNDDALSKNYGLLYCF
NT seq 498 nt   +upstreamnt  +downstreamnt
atggctgcagtctcccgggcatcactgctcctggctttcaccctgctctgcctgccctgg
cttgcagagaccggtgtcctcacaacaatgcccgtatcctggctttatgagtatgctgtg
atgcgcgcccatcgcgtgaactatctggcgtttgacatctacgagaagtttgaagacgct
cgtagcctgaaggaacagaaggatttcttccggcataaagccaggaccaccgtttgcttc
actacgtctgtcccatcaccagttaacaaagaggaaattctgcagaaatctaacctagag
ctgctcggcgactccctgctctcagatattcgtccaatctcagaatgttcctggtccctg
agggagacctttgcagaggctggaagatggcagccccagactggggagatattcaggcag
acctacaggatgtttgacataaactcgcagaacgatgacgcactgagcaagaactacggg
ctgctctactgcttctag

DBGET integrated database retrieval system