KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033484Help
Entry
101033484         CDS       T04350                                 

Definition
(RefSeq) anionic trypsin isoform X2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101033484
NCBI-ProteinID: XP_003929835
UniProt: A0A2K6UX74
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MNPLLILAFVGAAVAFPFDDDDKIVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVS
AAHCYKSRIQVRLGEHNIEVQEGNEQFINSAKVIRHPKYSSWTLNNDIMLIKLSSPAVIN
ARVSTISLPAACAATGTECLISGWGNTASSGADYPDVLQCLEAPVLSQAQCEASYPGQIT
ENMICVGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAQKNKPGVYTKVCNYVDWIK
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgcctttgtgggagctgctgttgctttcccctttgacgac
gatgacaagatcgttgggggctacacctgcgaggagaattctgtcccctaccaggtgtcc
ctgaacgctggctaccacttctgcggtggctccctcatcagcgatcagtgggtggtgtca
gcagctcactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
caggaggggaatgagcagttcatcaactcggccaaggtcatccgtcaccccaaatacagc
agctggacactgaacaatgacatcatgctgatcaagctctcctcgcctgctgtcatcaat
gcccgagtgtccaccatctctctgcccgccgcctgtgcagccactggcaccgagtgcctc
atctccggctggggcaacactgcgagctccggggccgactacccagatgtgctgcagtgc
ctggaggctcctgtgctgagtcaggctcagtgtgaagcctcctaccctggacagattacc
gaaaacatgatctgtgtgggcttcctcgagggaggcaaggattcctgccagggtgactct
ggtggccctgtggtctgcaacggagaactccaaggagttgtctcctggggctatggttgt
gcccagaagaacaagcctggagtctacaccaaggtctgcaactatgtggactggattaag
gaaaccattgctgccaacagctaa

DBGET integrated database retrieval system