KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033734
Entry
101033734         CDS       T04350                                 

Gene name
ARNT2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2 isoform X2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033734 (ARNT2)
   05202 Transcriptional misregulation in cancer
    101033734 (ARNT2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101033734 (ARNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101033734 (ARNT2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101033734 (ARNT2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 101033734
NCBI-ProteinID: XP_003921731
UniProt: A0A2K6TC59
LinkDB
Position
Unknown
AA seq 706 aa
MASDIPGSVTLPVAPMAATGQVRMAGAVPARGGKRRSGMDFDDEDGEGPSKFSRENHSEI
ERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPS
FLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDD
VEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHL
PLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVGQGSKYCL
VAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDIL
EFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYI
ICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPTGVHEAGKSVEKADAIFSQER
DPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQ
SSSSTSQNMSQISRQLNQSQVAWTGSRPPFPGQQLPSQSSKTQSSPFGIGTSHSYPADPS
SYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGE
QHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcttcagacatacctggatcggtgacgttgcccgttgcccccatggcggccaccgga
caggtgaggatggcgggggccgtgcctgcccgtggaggaaagcgacgttccggaatggac
ttcgatgatgaagatggtgaaggtcccagtaaattttcaagagagaatcatagcgagatt
gaaaggcgcagacggaacaagatgactcagtacatcacggagctctccgacatggtgccc
acgtgcagcgcgctggcccggaagccagacaagctcaccatcctccgcatggccgtctcg
cacatgaagtccatgaggggtacaggaaacaagtccaccgatggcgcgtacaagccttcc
ttcctcacagagcaggaactgaagcatctcatccttgaagcagctgatggatttctgttt
gtggtggctgctgagacaggacgggtgatttacgtgtctgactccgtcacccctgttctg
aaccagccccagtcagagtggtttgggagcacactctacgaacaggtgcatcctgatgac
gtggagaagctgagagagcaactgtgcacctcagaaaactcaatgacaggccggatcttg
gacctgaagacagggacggtcaagaaggaagggcagcagtcatctatgaggatgtgcatg
ggctcgcggcgctccttcatctgcaggatgaggtgtggaaatgctcctttggaccacctt
cctctaaacagaataactaccatgaggaaaaggttcaggaatggccttggccctgtgaaa
gaaggagaagctcaatacgctgtggtccactgcacaggatacatcaaggcctggccacca
gcaggaatgaccatacctgaagaagacgctgatgtggggcaaggcagtaaatattgcctc
gtggcaattgggagactccaggtgaccagctctcctgtatgcatggacatgaacgggatg
tcagtgcccacggagttcttatctcggcataactctgatggaatcatcacatttgtagat
ccaaggtgtatcagtgtcattggctaccaaccccaggatcttctgggaaaggacattttg
gaattctgccaccctgaggatcagagccatctgcgtgagagcttccagcaggtggttaag
ctgaaaggccaagtactgtcggtcatgtatcgatttcgcaccaagaaccgggagtggatg
ttgatccgcaccagcagcttcacgttccagaatccctattctgatgagatcgagtacatc
atctgcaccaacaccaacgtcaagcagcttcagcaacagcaggcggaattggaagtgcac
cagcgagacggattgtcatcgtatgacttatcccaggtcccagtccccaacctaccaacc
ggtgttcacgaggccgggaagtccgtggaaaaggcagatgcaatcttctcccaggaaaga
gatcctcggtttgctgaaatgtttgcagggatcagtgcgtcggagaagaagatgatgagc
tcagcctctgcggcagggacccagcagatctactcccaaggaagcccgtttccctctgga
cactctgggaaggccttcagctcttccgtggttcacgtgcctggagtgaatgatattcag
tcctcctcttccacgagccagaacatgtcccaaatctcccggcagctaaaccagagtcag
gtggcgtggacagggagtcgtccgccctttccgggacagcaactcccatctcagtccagc
aagacccagtcgtctccctttgggattggaacgagccacagctacccagcagacccctct
tcctacagccccctctccagcccagctacctcctcgccaagcgggaacgcctactccagt
cttgccaacaggactccggggttcgctgaaagtggacaaagcagcgggcagttccaaggg
cggccctcggaggtctggtcgcagtggcaaagccagcaccatggtcagcagagcggtgag
cagcactcccaccagcagcccggtcagactgaagtgttccaggacatgctgcccatgccg
ggagatcccacccaggggactggcaactataacatcgaagactttgccgacctcggcatg
tttccgccgttttctgagtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038733
Entry
101038733         CDS       T04350                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04066  HIF-1 signaling pathway
sbq04934  Cushing syndrome
sbq05200  Pathways in cancer
sbq05204  Chemical carcinogenesis
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101038733 (ARNT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038733 (ARNT)
   05204 Chemical carcinogenesis
    101038733 (ARNT)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101038733 (ARNT)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101038733 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101038733 (ARNT)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101038733 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS HAUS2
Other DBs
NCBI-GeneID: 101038733
NCBI-ProteinID: XP_010328097
LinkDB
Position
Unknown
AA seq 779 aa
MTSDVPSLGPAIASGNPGPGLQGGGAIVQRAIKRRPGLDFDDDGEGNGKFLRCDDDQMSN
DKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKL
TILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYV
SDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQ
QSSMRMCMGSRRSFICRMRCGSSAVDPVSVNRLSFVRNRCSSFFPIARLPPVGNCVWDKI
HRIAPPCPGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIE
GIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFR
SKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPALSNAIQRPQLGPTANL
PLEMGSGQLAPRQQQQQTELDMVPGRDGLASYSHSQVVQPVTTTGTEHSKPLEKSDGLFA
QDRDPRFSEIYHNISADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVT
IVQPSASAGQMLAQISRHSNPTQGAAPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSF
QTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQ
GQQPHHRSSSSEQHVQQSSAQQPGQPEVFQEMLSMLGEQSNSYNNEEFPDLTMFPPFSE
NT seq 2340 nt   +upstreamnt  +downstreamnt
atgacatcagatgtcccatcactgggtccagccattgcctctggaaaccctggacctgga
cttcaaggcggaggagccattgtccagagggctattaagcggcggccagggctggatttt
gatgatgatggagaagggaatggtaaatttttgaggtgtgatgatgatcagatgtctaac
gataaggagcggtttgccaggtcggatgatgaacagagctctgcggataaagagagactg
gccagggaaaatcatagtgaaattgaacggcggcgacggaacaagatgacagcctacatc
acagaactgtcagatatggtacccacctgtagtgccctggctcgaaaaccagacaagcta
accatcttacgcatggcagtttctcacatgaagtccctgcggggaactggcaacacgtcc
actgatggctcctataaaccgtcttttctcactgatcaggaactgaaacatttgatcttg
gaggcagcagatggctttctgtttattgtctcatgtgagacaggccgggtggtgtatgtc
tctgactcggtgactcctgttttgaaccagccacagtctgaatggtttggcagcacactc
tatgatcaggtgcacccagatgatgtggataaacttcgtgagcagctttccacttcagaa
aatgccctgacagggcgtatcctggatctaaagactggaacagtgaaaaaggaaggtcag
cagtcttccatgagaatgtgtatgggctcaaggagatcatttatttgccgaatgaggtgt
ggcagtagtgctgtggacccagtttctgtgaataggctgagctttgtgaggaacagatgc
agttccttcttcccgatagctcgactgcctccagtaggaaactgtgtttgggataaaatt
caccgtatagcgccaccatgcccaggtgtttccctcccagatgatgacccagaagctggc
cagggaagcaagttttgcctagtggccattggcagattgcaggtaactagttctcccaac
tgtacagacatgagtaacgtttgtcagccaacagagttcatctcccgacacaacattgag
ggcatcttcacttttgtggatcaccgctgtgtggctactgttggctaccagccgcaggag
ctattaggaaagaatattgtagaattctgtcatcctgaagaccagcagcttctaagagac
agcttccaacaggttgtgaaattaaaaggtcaagtgctgtctgtcatgttccggttccgg
tctaagaaccaagaatggctctggatgagaacaagctcctttactttccagaacccttac
tcagatgaaattgagtacatcatctgtaccaacaccaatgtgaagaactctagccaagaa
ccgcggcctgcactctccaacgcaatccagaggccacagctaggtcccacagctaattta
cccctggagatgggctcagggcagctggcaccaaggcagcagcaacagcaaacagaattg
gacatggtaccaggaagagatggactggccagctacagtcattcccaggttgttcagcct
gtgacaaccacaggaacagaacacagcaagccccttgagaagtcagatggtttatttgcc
caggatagagatccaagattttcagaaatctatcataacatcagtgcagatcagagtaaa
ggcatctcctccagcactgtccctgccacccaacagctattctcccagggcaacacattc
cctcctaccccccggccggcagagaatttcaggaatagtggtttagcccctcctgtaacc
atagtccagccatcagcttctgcaggacagatgttggcccagatttcccgccactccaac
cctacccagggagcagccccaacttggacccctactacccgctcaggcttttctgcccag
caggtggctacccaggctaccgcgaagactcgtacttcccaatttggtgtgggcagtttt
cagactccatcctccttcagctccatgtccctccctggtgctcccactgcatcacctggt
gctgctgcctaccctagtctcaccaatcgtggatccaactttgcccctgagactggacag
actgcaggacaattccagacacggacagcagagggtgtgggtgtctggccacagtggcag
ggccaacagcctcatcatcgttcgagttctagtgagcaacatgttcagcaatcatcagca
cagcaacctggccagcctgaggtcttccaggagatgctgtccatgctgggagagcagagc
aacagctacaacaatgaagaattccctgatctaaccatgtttcctcccttttcagaatag

DBGET integrated database retrieval system