KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033758
Entry
101033758         CDS       T04350                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04350  TGF-beta signaling pathway
sbq04371  Apelin signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04714  Thermogenesis
sbq04910  Insulin signaling pathway
sbq04931  Insulin resistance
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05221  Acute myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101033758 (RPS6KB2)
   04350 TGF-beta signaling pathway
    101033758 (RPS6KB2)
   04371 Apelin signaling pathway
    101033758 (RPS6KB2)
   04066 HIF-1 signaling pathway
    101033758 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    101033758 (RPS6KB2)
   04152 AMPK signaling pathway
    101033758 (RPS6KB2)
   04150 mTOR signaling pathway
    101033758 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101033758 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101033758 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101033758 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    101033758 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    101033758 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101033758 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033758 (RPS6KB2)
   05205 Proteoglycans in cancer
    101033758 (RPS6KB2)
   05231 Choline metabolism in cancer
    101033758 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101033758 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101033758 (RPS6KB2)
   05212 Pancreatic cancer
    101033758 (RPS6KB2)
   05225 Hepatocellular carcinoma
    101033758 (RPS6KB2)
   05226 Gastric cancer
    101033758 (RPS6KB2)
   05221 Acute myeloid leukemia
    101033758 (RPS6KB2)
   05224 Breast cancer
    101033758 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101033758 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101033758 (RPS6KB2)
   05163 Human cytomegalovirus infection
    101033758 (RPS6KB2)
   05165 Human papillomavirus infection
    101033758 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101033758 (RPS6KB2)
   01522 Endocrine resistance
    101033758 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101033758 (RPS6KB2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101033758 (RPS6KB2)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101033758 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 101033758
NCBI-ProteinID: XP_003941254
UniProt: A0A2K6TG76
LinkDB
Position
Unknown
AA seq 487 aa
MAAVFDLDLETEEGSDCEGEPELSPADVCPLAELRAAGLEPVGHYEEVELTESSVNLGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTCGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSLGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLV
KKFLKRNPNQRIGGGPGDAADVQKHPFFRHMNWDDLLARHVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
PISPLKFSPFEGFRPSPSLPEPMEPPLPPLLPPPPPPPPPPSITAPLPIRPPSGTKKSKR
GRGRPGH
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgatctggatttggagaccgaggaaggcagcgactgcgagggagag
ccagagctcagccccgcggacgtgtgtccccttgccgagttgagggcagctggcctggag
cctgtggggcactatgaagaggtggagctgactgagagcagcgtgaacctcggcccggag
cgcatcgggccccactgttttgagctgctgcgtgtgctgggcaagggaggctatggcaag
gtgttccaggttcgaaaggtgcaaggcaccaacttgggcaaaatatacgccatgaaagtc
ctaaggaaggccaaaattgtgcgcaacgccaaggacacagcacacactcgggctgagcgg
aatattctggagtcagtgaagcacccctttatcgtggaactggcctatgccttccagact
tgtggcaaactctacctcatcctcgagtgtctcagtggtggcgagctcttcacgcatctg
gagcgagagggcatcttcctggaagatacggcctgcttctacctggccgagatcactctg
gccctgggccatctccactccctgggcatcatctaccgggacctcaaacctgagaacatc
atgctcaacagccagggccacatcaaactgaccgactttggactctgcaaggagtcgatc
catgagggcgccatcactcacaccttctgcggcaccattgagtacatggcccctgagatt
ttggtgcgcagtggccacaaccgggctgtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccacccttcaccgcagagaaccggaagaaaaccatggataag
atcatcaagggcaagctggtgctgcccccctacctcaccccagatgcccgggaccttgtc
aaaaagtttctgaaacggaatcccaaccagcggattgggggtggcccaggggatgctgct
gatgtgcagaagcacccctttttccggcacatgaattgggatgaccttctggcccgccac
gtggacccccctttcaggccctgtctgcagtcagaggaggatgtgagccagtttgacacc
cgcttcacgcgacagacgccggtggacagtccggatgacacggccctcagcgagagtgcc
aaccaggccttcctgggcttcacgtacgtggcgccgtctgtcctggacagcatcaaggag
ggcttctccttccagcccaagctgcgctcacccaggcgcctcaacagcagcccccgggcc
cccatcagccccctcaagttctccccctttgaggggtttcggcctagccccagcctgcca
gagcccatggagccacctctgcctccactcctgccaccgccgccaccaccaccaccaccg
ccctcgatcaccgcccctctccccatccgtcccccctcagggaccaagaagtccaagagg
ggccgtgggcgtccagggcactaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101038541
Entry
101038541         CDS       T04350                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04012  ErbB signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04350  TGF-beta signaling pathway
sbq04371  Apelin signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04714  Thermogenesis
sbq04910  Insulin signaling pathway
sbq04931  Insulin resistance
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05221  Acute myeloid leukemia
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101038541 (RPS6KB1)
   04350 TGF-beta signaling pathway
    101038541 (RPS6KB1)
   04371 Apelin signaling pathway
    101038541 (RPS6KB1)
   04066 HIF-1 signaling pathway
    101038541 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    101038541 (RPS6KB1)
   04152 AMPK signaling pathway
    101038541 (RPS6KB1)
   04150 mTOR signaling pathway
    101038541 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101038541 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101038541 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101038541 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    101038541 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    101038541 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101038541 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101038541 (RPS6KB1)
   05205 Proteoglycans in cancer
    101038541 (RPS6KB1)
   05231 Choline metabolism in cancer
    101038541 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101038541 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101038541 (RPS6KB1)
   05212 Pancreatic cancer
    101038541 (RPS6KB1)
   05225 Hepatocellular carcinoma
    101038541 (RPS6KB1)
   05226 Gastric cancer
    101038541 (RPS6KB1)
   05221 Acute myeloid leukemia
    101038541 (RPS6KB1)
   05224 Breast cancer
    101038541 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101038541 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101038541 (RPS6KB1)
   05163 Human cytomegalovirus infection
    101038541 (RPS6KB1)
   05165 Human papillomavirus infection
    101038541 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101038541 (RPS6KB1)
   01522 Endocrine resistance
    101038541 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101038541 (RPS6KB1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101038541 (RPS6KB1)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101038541 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101038541
NCBI-ProteinID: XP_003929133
UniProt: A0A2K6SQD7
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgaaggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccggaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatatcagaaactagtgtgaac
agagggccggaaaaaatcagaccggaatgttttgaactacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagttagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcctttcatcgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagatctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccattcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtctgggagccggtcct
ggagacgctggagaagttcaagctcatccattctttagacacattaactgggaagaactt
ctggctcgaaaggtggagcccccttttaaacctctgttgcaatctgaagaggatgtaagt
caatttgattccaagtttacacgtcagacacccgttgacagcccagatgactcaactctc
agtgaaagtgccaatcaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcccggggatttctggggaagaggt
gcttcggccagcacagcaaatcctcagacgcctgtggaatacccaatggaaacaagtggc
atagagcagatggacgtgacaatgagtggggaagcatcagcaccacttccaatacgacag
ccgaactctgggccatacaaaaaacaagcttttcccatgatctctaaacggccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system