KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033759Help
Entry
101033759         CDS       T04350                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00590  Arachidonic acid metabolism
sbq01100  Metabolic pathways
sbq04611  Platelet activation
sbq04726  Serotonergic synapse
sbq04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101033759 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101033759 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101033759 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    101033759 (PTGS1)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101033759 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 101033759
NCBI-ProteinID: XP_003925205
LinkDB All DBs
Position
Unknown
AA seq 599 aa AA seqDB search
MSRSLLLRFSLFLLLLQPPPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPELWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNAAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMRYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIRIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIALEFNQLYHWHPLMPDSFKVGSREYSYEQFLFNTSMLVDYGVEA
LVDAFSRQSAGRIGGGRNMDHHVLHVAVDVIRESRELRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEMGFNIVKTATLKKLVCLNTKTCPYVSFRVPGGSQDEGPAVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagtctcttgctccggttctcgctgttcctgctcctactgcagccgcccccg
gtcctgctcgcggaccccggggcgcccacgccagtgaatccctgttgttactatccatgc
cagcaccagggcatctgtgtccgctttggccttgaccgctaccagtgtgactgcacccgc
acgggctattccggccccaactgcaccatccctgagctgtggacctggctccggaactca
ttgcggcccagcccctctttcacgcactttctgctcacgcacgggcgctggttctgggag
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtcccccaacctacaacgcagcacacgactacatcagctgggagtct
ttctccaacgtgagctattacactcgtattctgccctctgtgcctaaagactgccccaca
cccatgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttc
ttgctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggtcacatttatggagacaatctggagcgtcag
tatcaactgcggctctttaaggatgggaaactcaagtaccaggtgctggacggagaaatg
taccctccctccgtagaagaggcgcctgtgttgatgcgctaccctcgaggcatcccgccc
cagagccagatggctgtgggccaggaggtgtttgggctgcttcctgggctcatgctgtat
gccacgctctggctgcgcgagcacaatcgtgtgtgtgacctgctgaaagctgagcacccc
acctggggcgatgagcagctcttccagacgacccgcctcatcctcataggagagaccatc
aggattgttatcgaggagtacgtgcagcagttgagtggctatttcctgcagctgaagttc
gacccagagctgctcttcggtgtccagtttcagtaccgcaaccgcattgccttggagttc
aaccagctctaccactggcaccccctcatgcccgactccttcaaggtgggctcccgggag
tacagctacgagcagttcttgttcaacacctccatgttggtggactacggggttgaggcc
ctggtggatgccttctctcgccagagcgctggccggatcggtgggggcaggaacatggac
caccacgtcctgcacgtggctgtggatgtcatcagggagtctcgggagctgcggctgcag
cccttcaatgagtaccgcaagaggtttggcatgaagccctatacctccttccaggagctt
gtaggagagaaggagatggcagcagagttggaggagttgtatggagacattgatgccttg
gagttctaccccgggctgcttcttgaaaagtgccatccgaactctatctttggggagagt
atgatagagattggggctcctttttccctcaagggtctcctagggaatcccatctgttct
ccggaatactggaagccgagcacatttggtggcgagatgggctttaacatcgtcaagacg
gccacactgaagaaactggtctgcctcaacaccaagacctgtccctacgtttccttccgc
gtgccgggtggcagtcaggatgaggggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system