KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101033803
Entry
101033803         CDS       T04350                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04024  cAMP signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04310  Wnt signaling pathway
sbq04330  Notch signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04520  Adherens junction
sbq04630  JAK-STAT signaling pathway
sbq04720  Long-term potentiation
sbq04916  Melanogenesis
sbq04919  Thyroid hormone signaling pathway
sbq04922  Glucagon signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05016  Huntington disease
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05211  Renal cell carcinoma
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101033803 (EP300)
   04330 Notch signaling pathway
    101033803 (EP300)
   04350 TGF-beta signaling pathway
    101033803 (EP300)
   04630 JAK-STAT signaling pathway
    101033803 (EP300)
   04066 HIF-1 signaling pathway
    101033803 (EP300)
   04068 FoxO signaling pathway
    101033803 (EP300)
   04024 cAMP signaling pathway
    101033803 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101033803 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101033803 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101033803 (EP300)
   04935 Growth hormone synthesis, secretion and action
    101033803 (EP300)
   04919 Thyroid hormone signaling pathway
    101033803 (EP300)
   04916 Melanogenesis
    101033803 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    101033803 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101033803 (EP300)
   05206 MicroRNAs in cancer
    101033803 (EP300)
   05203 Viral carcinogenesis
    101033803 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101033803 (EP300)
   05215 Prostate cancer
    101033803 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101033803 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101033803 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101033803 (EP300)
   05161 Hepatitis B
    101033803 (EP300)
   05164 Influenza A
    101033803 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101033803 (EP300)
   05165 Human papillomavirus infection
    101033803 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101033803 (EP300)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101033803 (EP300)
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101033803 (EP300)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101033803 (EP300)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    101033803 (EP300)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101033803 (EP300)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101033803 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 101033803
NCBI-ProteinID: XP_003932886
UniProt: A0A2K6TPE7
LinkDB
Position
Unknown
AA seq 2420 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMATQAQQNSPGLGLINS
MVKSPMTQASLTSPNMGMGASGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKVGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLPPFAMDKKTVPGGGMP
NMGQQPASQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSTPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVASLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPTMIRGSVPNQMIPRITPQSGLNQFGQMSM
AQPSIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSSQSQFLPQTQFPSQGMNVTNM
PLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATAIPAPVPTPPAMPSGPQSQALHPPPRQTPTPPPTQLTPQVQSS
LPAAPSADQSQQQPRSQQSTAASVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSST
EVNSQAIPEKQLSQEVKMETKMEVDQPEPADTQPEDITESKVDDCKVEPTETEERGTESK
TEIKEEEDQSSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPATPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMAPMAPMGMNPPPMTRGPSGHL
EPGMGPTGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQSL
PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
MSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGSGPGMGPGMANHNQFQQPQGVGYP
PQQQQQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQ
PNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQ
PSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPEQNSMLSQLTSNPGMANLHGASATDLG
LSTDNSDLNSNLSQSTLDIH
NT seq 7263 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctctttgacttggag
cacgacttaccagatgaattaatcaactctacagagttgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggcatagtacaagatgcagcttctaaacataaacag
ctatcagaattgctgcgatctggtagttcgcctaacctcaatatgggagttggtggccca
ggtcaagtcatggccacccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatgacacaggccagcttgacttctcccaacatgggaatgggcgct
agtggaccaaatcagggtcctacgcagtcaacaggtatgatgaacagtccagtaaatcag
cctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggctgca
ggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagcaggccga
ggacgacagaatatgcagtacccaaacccaggcatgggaagtgctggcaacttactgact
gagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggcccccag
cctcttaaggtgggaatgatgaacaatcccaatccttatggttcaccatatactcagaat
cctggacagcagattggagccagtggccttggtctccagattcaaacaaagactgtacta
tcaaataacttacctccatttgctatggacaaaaagacagttcctggtggaggaatgccc
aacatgggccaacagccagcctcgcaggtccagcagccaggcctggtgactccagttgcc
caagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccagcag
caacttgttctccttttgcatgctcacaagtgccagcgcagagagcaagccaatggggaa
gtgaggcaatgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccacatgaca
cactgtcagtcaggcaagtcttgccaagtggcacactgtgcatcttctcgacaaatcatt
tcacactggaagaattgtacaagacatgattgtcctgtgtgtctccccctcaaaaatgct
ggtgataagagaaatcaacagccaattttgactggagcacctgttggacttggaaatcct
agctctctaggggtgggtcaacagtctacccccaacctaagtactgttagtcagattgat
cccagctctatagaaagagcctatgcagctcttggactaccctatcaagtaaatcagatg
ccaacacaaccccaggtgcaagcaaagaaccagcagaatcagcagtctgggcagtctccc
caaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggtgta
ggagttcaaacgccgagtcttctttctgactcaatgttgcattcagctataaattctcaa
aacccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagcagct
caaccatccactactggaattcgaaaacagtggcatgaagatattactcaggatcttcga
aatcatcttgttcacaaactcgtccaagccatatttcctacaccggatcctgctgcttta
aaagacagacggatggaaaacctagttgcatatgctcggaaagtcgaaggggacatgtat
gaatctgcaaacaatcgagcggaatactaccaccttctagctgagaaaatctataagatc
cagaaagaactagaagaaaaacgaaggactagactacagaaacagaacatgctaccaaat
gctgcaggcatggttccagtttccatgaatccagggcctaacatgggacagccgcaacca
ggaatgacttctaatggtcctctgcctgatccaactatgatccgtggcagtgtgccaaac
cagatgatccctcggataactccacagtctggtttgaatcaatttggccagatgagcatg
gcccagccctctattgtaccccggcaaacccctcctcttcagcaccatggacagttggct
cagcctggagctctcaacccgcctatgggctatgggcctcgtatgcagcagccttccagc
cagagccagttccttccccagactcagttcccatcacagggaatgaatgtaacaaatatg
cctttggctccgtccagcggtcaagctccagtgtctcaagcacaaatgtctagttcttcc
tgcccagtgaactctcctataatgcctccagggtctcaggggagccacattcattgtccc
cagcttcctcaaccagctctgcatcagaattccccctcgcctgtacctagtcgtacccct
accccccaccatactcccccaagcataggggcgcagcagccaccagcaacagcaattcca
gcccctgttcctacgcctcctgccatgccatctgggccacagtcccaggccttacatccc
cctccaaggcagacacctacaccaccaccaacacaacttaccccacaagtgcagtcttca
cttcctgctgctccttcagctgaccagtcccagcagcagcctcgctcacagcagagcaca
gcagcctctgttcctaccccaacagcaccgctgcttcctccacagccttcaactccactt
tcccagccagctgtaagcattgaaggacaggtatcaaaccctccatctactagtagcaca
gaagtgaattctcaggccattcctgagaagcaactttcccaggaagtgaaaatggagact
aaaatggaggtggatcaaccagaaccagcagatactcagccggaggatattacagagtct
aaagtagatgactgtaaagtggaacctacagaaacagaagagagaggcactgaatcaaaa
actgaaataaaagaggaggaagaccagtcaagtacttcagctacccagtcatctccagct
ccaggacagtcaaagaaaaagattttcaaaccagaagaactacgacaggcattaatgcca
acattggaggcactttaccgtcaggatccagaatcccttccttttcgtcagcctgtggac
cctcagcttttaggaatccctgattactttgatattgtgaagagccctatggatctttct
acaattaagaggaagttagacactggacagtatcaggagccctggcaatatgttgatgat
atttggcttatgttcaataatgcctggttatataaccggaaaacatcacgggtatacaaa
tactgctccaaactatctgaggtctttgaacaggaaattgacccagtgatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactgtgttgctatggcaaa
cagttatgcacaatacctcgtgatgccacttactacagttaccagaacaggtatcatttc
tgtgagaagtgtttcaatgagatccaaggggagagcgtttctttgggggatgacccttcc
cagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactggat
cctgaactgtttgttgaatgtacagagtgcggaagaaagatgcatcaaatctgtgtcctt
caccatgagatcatctggcccgctggattcgtctgtgatggctgtttaaagaaaagtgca
cgaactaggaaagaaaataagttttctgctaaaaggttgccatctaccagacttggcacc
tttctagagaatcgtgtgaatgactttctgaggcgacagaatcaccctgagtcaggagag
gtcactgttagagtagttcatgcttctgacaaaaccgtggaagtaaaaccaggcatgaaa
gcaaggtttgtggacagtggagagatggcagaatcctttccataccgaaccaaagccctg
tttgcctttgaagaaattgatggtgttgacctgtgcttctttggcatgcatgttcaagag
tatggctctgactgccctccacccaaccagaggagagtatacatatcttacctcgatagt
gttcatttcttccgtccgaaatgcctgaggactgcagtctatcatgaaatcctaattgga
tatttagaatatgtcaagaaattaggttatacaacagggcatatttgggcatgtccacca
agtgagggagatgattatatcttccattgccatcctcctgaccagaagatacccaagccc
aagcgactgcaggaatggtacaaaaaaatgcttgacaaggctgtatcagagcgtattgtc
catgactacaaggatatttttaaacaagctactgaagatagattaacaagtgcaaaggaa
ttgccttacttcgagggtgatttctggcccaatgttctggaagaaagcattaaggaactg
gaacaagaggaggaagagagaaaacgagaagaaaacaccagcaatgaaagcacagatgtg
accaagggagacagcaaaaatgctaaaaagaagaataataagaaaaccagcaaaaataag
agcagcttgagtaggggcaacaagaagaaacctgggatgcccaatgtatctaacgacctc
tcacagaaactgtatgccaccatggagaagcataaagaggtcttctttgtgatccgcctc
attgctggccctgctgcaaactccctgcctcccattgttgaccctgaccctctcatcccc
tgcgatctgatggatggtcgggatgcatttctcacgctggcaagggacaagcacctggaa
ttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacg
cagagccaggaccgctttgtctacacctgcaatgaatgcaagcaccacgtggagacacgc
tggcactgcactgtctgtgaggattatgacttgtgtatcacctgctataacactaaaaac
catgaccacaaaatggagaaactaggtctgggcttagatgatgagagcaacaaccagcag
gctgcagccacccagagcccaggcgattctcgccgcctgagtatccagcgctgcatccag
tctctggtccatgcttgccagtgtcggaatgccaattgctccctgccctcctgccagaag
atgaagcgggttgtacagcatactaagggttgcaaacggaaaaccaacggtggatgcccc
atctgcaagcagctcattgccctctgctgctaccatgccaagcactgccaggagaacaaa
tgcccggtgccattctgcctaaatatcaaacagaagctccggcaacagcagctccagcac
cgactgcagcaggcccagatgcttcgcaggcggatggccagcatgcagcggactggtgtg
gtcgggcagcaacagggcctgccttcccccactcctgccactccaacaacaccaactggc
caacagccagccaccccacagacaccccagcccacctctcagcctcagcctacccctccc
aatagcatgccaccctacttgcccaggactcaagctgctggccctgtgtcccagggtaag
gcagcaggccaggtgacccctccaacccctcctcagactgctcagccaccccttccaggg
cccccacctgcagcagtggaaatggcaatgcagattcagagagcagcagagacacagcgg
cagatggcccatgtgcaaatttttcaaaggccaatccaacaccaaatgcctccaatggct
cctatggcccccatgggtatgaacccacctccgatgaccagaggtcctagtgggcatttg
gagccagggatgggacccacagggatgcagcaacagccaccctgggcccaaggaggattg
cctcagccccagcaactacagtctgggatgccaaggccagccatgatgtcagtggcccag
catggtcaacccttgaacatggctccacaaccaggactgggccaggtaggtgtgagccca
ctcaaaccaggcactgtgtctcagcaagccttacaaaaccttctgcggactctcaggtct
cccagctctcctttacagcagcaacaggtgcttagtatccttcacgccaacccccagctg
ttggctgcattcatcaagcagcgagctgccaagtatgccaactctaatccgcaatccctc
cctgggcagcctggcatgccccaggggcagccaggactacagccacctaccatgccaggg
cagcagggggtccactccaatccagccatgcagaacatgaatccaatgcaggcaggtgtc
cagagggctggcctgccacagcagcaaccacagcagcaactccagccacccatgggaggg
atgagcccccaagctcagcagatgaacatgaaccacaacaccatgccttcacagttccga
gacatcttgagacgacagcagatgatgcagcaacagcagcaacagggatcagggccagga
atgggtcctggaatggccaaccataatcagttccagcaaccccaaggagttggctaccca
ccacagcagcaacagcagcagcagcagcagcagcggatgcagcatcacatgcaacagatg
caacaaggaaatatgggacagatgggccagctcccccaggccttgggagcagaggcaggt
gccagtctgcaggcctatcagcagcgactccttcagcaacagatggggtcccctgctcag
cccaaccccatgagcccccagcagcatatgctcccaaatcaggcccagtccccacaccta
caaggccagcagatccctaattctctctccaatcaagtgcgttctccccagcctgtccct
tctccacggccacagtcccagcccccccactccagcccttccccaaggatgcagcctcaa
ccttctccacaccatgtttccccacagacaagttccccacatcctggattggtagctgcc
caggcaaaccccatggaacaagggcattttgccagcccggagcagaattcaatgctttct
cagcttactagcaatccaggcatggcaaacctccatggtgcaagcgccacggacctggga
ctcagcaccgataactcagacttgaattcaaacctctcacagagtacactagacatacac
tag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101050224
Entry
101050224         CDS       T04350                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04024  cAMP signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04310  Wnt signaling pathway
sbq04330  Notch signaling pathway
sbq04350  TGF-beta signaling pathway
sbq04520  Adherens junction
sbq04630  JAK-STAT signaling pathway
sbq04720  Long-term potentiation
sbq04916  Melanogenesis
sbq04919  Thyroid hormone signaling pathway
sbq04922  Glucagon signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05016  Huntington disease
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05211  Renal cell carcinoma
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101050224 (CREBBP)
   04330 Notch signaling pathway
    101050224 (CREBBP)
   04350 TGF-beta signaling pathway
    101050224 (CREBBP)
   04630 JAK-STAT signaling pathway
    101050224 (CREBBP)
   04066 HIF-1 signaling pathway
    101050224 (CREBBP)
   04068 FoxO signaling pathway
    101050224 (CREBBP)
   04024 cAMP signaling pathway
    101050224 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101050224 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101050224 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101050224 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    101050224 (CREBBP)
   04919 Thyroid hormone signaling pathway
    101050224 (CREBBP)
   04916 Melanogenesis
    101050224 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    101050224 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101050224 (CREBBP)
   05206 MicroRNAs in cancer
    101050224 (CREBBP)
   05203 Viral carcinogenesis
    101050224 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101050224 (CREBBP)
   05215 Prostate cancer
    101050224 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101050224 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101050224 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101050224 (CREBBP)
   05161 Hepatitis B
    101050224 (CREBBP)
   05164 Influenza A
    101050224 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101050224 (CREBBP)
   05165 Human papillomavirus infection
    101050224 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101050224 (CREBBP)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101050224 (CREBBP)
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101050224 (CREBBP)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101050224 (CREBBP)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    101050224 (CREBBP)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101050224 (CREBBP)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101050224 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 101050224
NCBI-ProteinID: XP_003928519
LinkDB
Position
Unknown
AA seq 2448 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLTSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGK
SPLSQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKLATSSPTTSQTGPGICMNANFNQ
THPGLLNSNSGHSLMNQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLAETL
TQVSPQMAGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPLGATGVNPQLAGKQSM
VNSLPTFPTDIKNTSVTNVPNMSQMQTTVGIVPTQAIATGPTADPEKRKLIQQQLVLLLH
AHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCT
RHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQR
AYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMTIPAGGITTDQQPP
NLISESALPTSLGAANPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSH
LVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQK
ELEEKRRSRLHKQGILGNQPALPAPGAQPAVIPQAQPVRPPNGPLPLPVNRMQVSQGMNS
FNPMSLGNVQLPQAPMGPRTASPMNHSVQINSMGSVPGMAISPSRMPQPPNMMGAHTNNM
MAQAPTQSQFLPQNQFPSSSGAMSVNSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQA
SQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTPPGMTPPQPAAPTQPSTPVSSSGQTPT
PTPGSVPSATQTQSTPTVQTAAQSQVTPQPQTPAQPPSVATPQSSQQQPTPVHAQPPGTP
LSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKAEAQTEDTEPDPGESKGEPRSE
MMEEDLQGASQVKEETDTTEQKSEPMEVDEKKPEVKVEVKEEEESSTNGTASQSTSPSQP
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKR
KLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCC
GRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQT
TISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRK
ENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFV
DSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFF
RPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEE
EERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQK
LYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSS
LRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAH
KMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKR
VVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQ
QAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAG
FPSVARTQPPTTVSAGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNG
MPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGMPRPVM
SMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAF
IKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMQPQPGIHQQPSLQNLNAMQAGVPRPGV
PPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQ
QQGNAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLSQM
GQPGMGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQ
IATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASS
IDQGHLGNPEQSAMLPQLNTPSRSTLSSELSLVGDTTGDTLEKFVEGL
NT seq 7347 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggacctcctaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatacccaatggaggagaattaggccttttaaccagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctacgaggaggcagcagctct
agtatcaacccaggaataggaaatgtgagcgccagcagccccgtgcagcagggcctgggt
ggccaggctcaagggcagccgaacagtgcgaacatggccagcctcggtgccatgggcaag
agtcctctgagccagggagattcttcagcccccagcctgccaaaacaggcagccagcacc
tctgggcccaccccacctgcctcccaggcactgaatcctcaagcacaaaagctggcaact
agcagccctaccacgtcacagactggacctggtatctgcatgaatgctaactttaaccag
acccacccaggcctcctcaatagtaactctggccatagcttaatgaatcaggcttctcaa
ggacaggcgcaagtcatgaatggatctcttggggctgctggcagaggaaggggagctgga
atgccgtaccctactccagccatgcagggggccacgagcagcgtgctggctgagacccta
acgcaggtttcccctcaaatggccggtcacgcaggactgaacaccgcacaggcaggaggc
atggccaagatgggaataactgggaacacaagtccatttggacagccctttagtcaagct
ggagggcagccattgggagccactggagtgaacccccagttagccggcaaacagagcatg
gtcaacagtttgcccaccttccctacagacatcaagaatacttcagtcaccaacgtgcca
aatatgtcccagatgcaaacaacagtgggaattgtacccacacaagcaattgcaacgggc
cccactgcagatcctgaaaaacgcaaactgatacagcagcagctggttctactgcttcat
gctcataagtgtcagagacgagagcaagcaaacggagaggttcgggcctgctcgctccca
cactgtcgaaccatgaaaaacgttttgaatcacatgacgcactgtcaggctgggaaagcc
tgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaactgcaca
cgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaaccaacaa
accatcctggggtctccggctagtgggattcaaaacacaattgggtctgttggcacaggg
caacagaatgccacttctttaagtaacccaaatcccatagaccccagctccatgcagcga
gcctatgctgctctcggactcccctacatgaaccagccccagacgcagctgcagcctcag
gttcctggccagcaaccagcacagcctcaaacccaccagcagatgaggactctgaatccc
ctgggaaataacccaatgaccattccagcaggaggaataacaacagatcagcagccccca
aacttgatttcagaatccgctcttccaacttccctgggggctgcaaaccccctgatgaac
gatggctccaactctggtaacattggaaccctcagcactataccaacagcagctcctcct
tccagcactggtgtaaggaaaggctggcatgaacatgtcactcaggacctgcggagccat
ctagtgcataaactagtccaagccatcttcccaacacctgatcccgcagctctaaaggat
cgccgcatggaaaacctggtagcctatgctaagaaagtggaaggggacatgtatgagtct
gccaacagcagggatgaatattatcacttactagcagagaaaatctacaagatacaaaaa
gaactagaagaaaaaaggaggtcgcgtttacataaacaaggcatcttggggaaccagcca
gccttaccagccccaggggctcagcccgctgtgattccacaggcacaacctgtgagaccc
ccaaatggacccctaccccttccagtgaatcgcatgcaagtttctcaagggatgaattca
tttaaccccatgtctttggggaacgtccagttgccacaagcacccatgggacctcgtaca
gcctccccaatgaaccactctgtacagatcaacagcatgggctcagttcctgggatggcc
atttctccttcccgaatgcctcagcctccgaacatgatgggtgcgcacaccaacaacatg
atggcccaggctcccactcagagccagtttctgccacaaaaccagttcccgtcatccagc
ggagcgatgagtgtgaacagtgtggggatgggccagccgccagcccagacaggcgtgtca
cagggacaggtgcctggtgctgctcttcctaaccctctcaacatgttggggcctcaggcc
agccagctgccctgccctccagtgacacagtcaccattgcacccgacgccacctcctgct
tccacggctgctggcatgccatctctccagcaccctacaccacctgggatgactcctccc
cagccagcagctcccactcagccatcaactcctgtgtcgtcttccgggcagactcctacc
ccaactcccggctcagtgcccagtgctactcaaacccagagcacccctacagtccaaaca
gcagcccagtcccaggtgaccccgcagcctcaaaccccagctcaacccccgtctgtggct
acccctcagtcatcgcagcagcagccaacacctgtgcatgcccagcctcctggcacgccg
ctttcccaggcagcagccagcattgataacagggtccctaccccgtcctcagtagccagt
gcagaaaccaattcccagcagccaggacctgatgtacctgtgctagaaatgaaggcggag
gcccagacggaggacactgagcctgatcctggtgaatccaagggggagcccaggtctgag
atgatggaggaggatttgcaaggtgcttctcaagttaaagaagaaacagatacaacagag
cagaaatcagaaccaatggaagtggatgaaaagaaacctgaagtgaaagtagaagttaaa
gaggaagaagagagtagtactaacggcacagcctctcagtcaacatctccttcacagcca
cgcaaaaaaatctttaaaccagaggagttacgtcaggccctcatgccaaccctagaagca
ctgtatcgacaggacccagagtctttaccttttcggcagcctgtagatccccagctcctt
ggaattccagattattttgacattgtaaagaatcccatggacctctcgaccatcaagcgg
aagctggacacggggcaataccaagagccctggcagtatgtggatgacgtctggctcatg
ttcaacaatgcctggctctataatcgcaagacatcccgagtctataagttttgcagtaag
cttgcagaggtttttgagcaggaaattgaccctgtcatgcagtcccttggatattgctgt
ggacgcaagtatgagttttctccacagactttgtgctgttatgggaagcagctgtgtacc
attcctcgcgatgctgcatactacagctatcagaataggtatcatttctgtgagaagtgt
ttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcacagccccaaacg
acaatttcaaaggatcagtttgaaaagaagaaaaacgataccttagaccctgaacctttc
gttgattgcaaggagtgtggccggaagatgcatcagatttgcgttctgcactatgacatc
atttggccttcaggttttgtgtgcgataactgcttgaagaaaactggcagacctcgaaaa
gaaaacaagttcagtgctaagagactgcagaccacgagactgggaaaccacttggaagac
cgagtcaacaaatttttgcgacgccagaatcaccctgaagccggggaggtttttgttcga
gtggtggccagctcagacaagacggtggaggtcaagcctggaatgaagtcacggtttgtg
gattctggggaaatgtctgaatctttcccatatcgaaccaaagcgctgtttgcttttgag
gaaattgacggcgtggatgtctgcttttttggaatgcacgtccaagaatatggctctgat
tgcccccctccaaatacgaggcgagtgtacatttcttatctggatagtattcatttcttc
cggccgcgttgcctccgcacagccgtttaccatgagatccttattggatatctagagtat
gtgaagaaattggggtatgtgacagggcacatctgggcctgtcctccaagtgaaggagat
gattacatcttccattgccacccacctgatcaaaaaatccctaagccaaaacgactgcag
gaatggtacaagaagatgctggacaaggcatttgcagagcggatcattcatgactacaag
gatattttcaaacaagcaactgaagacagactcaccagtgccaaggaactgccctatttt
gaaggtgatttctggcccaatgtgttagaagagagcattaaggaactagaacaagaagaa
gaggagaggaaaaaggaagagagcactgcagccagtgaaaccaccgagggcagtcagggc
gacagcaagaatgccaagaagaagaacaataagaagaccaacaagaacaaaagcagcatc
agccgcgccaacaagaagaagcccagcatgcccaacgtgtccaatgacctgtcccagaag
ctctatgccaccatggagaagcacaaggaggtcttcttcgtgatccacctgcacgccggg
cctgtcatcaacaccttgccccccatcgtcgaccctgatcccctgcttagctgcgacctc
atggacgggcgagatgccttcctcaccctggccagagacaagcactgggagttctcctcc
ttgcgccgctccaagtggtccacgctgtgtatgctggtggagctgcacacccagggccag
gaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacgcgctggcactgc
actgtgtgtgaggactacgacctctgcatcaactgctataacacgaagagccatgcccat
aagatggtgaagtgggggctgggcctggacgacgagggcagcagccagggcgagccacag
tcaaagagcccccaggagtcccgccggctgagcatccagcgctgcatccagtcgctggtg
cacgcgtgccagtgccgcaacgccaactgctcactgccatcctgccagaagatgaagcgg
gtggtgcagcacaccaagggctgtaagcgcaagaccaatgggggctgcccggtgtgcaag
cagctcatcgccctctgctgctaccacgccaagcactgccaagaaaacaaatgccccgtg
cccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcaccgcctgcag
caggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcag
agtctgccttctcctacctcagcaccacccgggacccccacgcagcagcccagcacgccc
cagacaccgcaaccccctgcccagccccagccctcacccgtgagcatgtcaccagctggc
ttccccagcgtggcccggactcagccccccaccacggtgtctgcagggaagcccaccagc
caggtgccagcacccccacccccagcccagcctccacctgcagcggtggaagcagctcgg
cagattgagcgtgaggcccagcagcagcagcacctgtaccgggtgaacatcaacaacggc
atgcccccggggcgcacgggcatggggactccaggaagccagatggcccccgtgagcctg
aacgtgccccgacccaaccaggtgagcgggcccgtcatgcccagcatgcctcccggccag
tggcaacaggcaccccttccccagcagcagccgatgccaggcatgcccaggcctgtgatg
tccatgcaggcccaggcagctgtggccgggccccggatgcccagcgtgcagccacccaga
agcatctcccccagcgccctgcaagacctgctgcggaccctgaagtcacccagctcccct
cagcagcagcagcaggtgctgaacattctcaagtcaaacccgcagctaatggcagctttc
atcaaacagcgcacagccaagtatgtggccaatcagcctggcatgcagccccagcccggc
ctccagtcccagcccggcatgcagccccagcccggcatgcagccccagcctggcatacac
cagcagcccagcctgcagaacctgaacgccatgcaggctggcgtgccgcggcctggtgtg
cctccacagcagcaggcgatgggaggcctgaacccccagggccaggccctgaacatcatg
aacccaggacacaaccccaacatggcgagtatgaatccacagtaccgagaaatgttacgg
aggcagctgctgcagcagcagcagcaacagcaacagcagcagcagcaacagcagcagcag
cagcaagggaatgctggcatggctgggggcatggcagggcacggccagttccagcagcct
caaggacctggaggctacccaccagccatgcagcagcagcagcgcatgcagcagcatctc
cccctccagggcagctccatgggccagatggcggcccagatgggacagctcagccagatg
gggcagccagggatgggggcagacagcacccccaacatccagcaagccctgcagcagcgg
attctgcagcaacagcagatgaagcagcagattgggtccccaggccagccgaatcccatg
agcccccagcaacacatgctctcaggacagccacaggcctcgcatctccctggccagcag
atcgccacatcccttagtaaccaggtgcggtctccagcccctgtccagtctcctcggccc
cagtcccagcctccacattccagcccgtcaccacggatacagccccagccttcgccacac
cacgtctcaccccagactggttccccccaccccggactcgcagttactatggccagctcc
atagatcagggacacttggggaaccccgaacagagtgcaatgctcccccagctgaacacc
cccagcaggagcacgctgtccagcgaactgtccctggtcggggacaccacgggggacaca
ctagagaagtttgtggagggcttgtag

DBGET integrated database retrieval system