KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034085
Entry
101034085         CDS       T04350                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04380  Osteoclast differentiation
sbq04612  Antigen processing and presentation
sbq04668  TNF signaling pathway
sbq04710  Circadian rhythm
sbq04713  Circadian entrainment
sbq04714  Thermogenesis
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04931  Insulin resistance
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04962  Vasopressin-regulated water reabsorption
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101034085 (CREB1)
   04024 cAMP signaling pathway
    101034085 (CREB1)
   04022 cGMP-PKG signaling pathway
    101034085 (CREB1)
   04151 PI3K-Akt signaling pathway
    101034085 (CREB1)
   04152 AMPK signaling pathway
    101034085 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101034085 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    101034085 (CREB1)
   04922 Glucagon signaling pathway
    101034085 (CREB1)
   04915 Estrogen signaling pathway
    101034085 (CREB1)
   04926 Relaxin signaling pathway
    101034085 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    101034085 (CREB1)
   04918 Thyroid hormone synthesis
    101034085 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    101034085 (CREB1)
   04916 Melanogenesis
    101034085 (CREB1)
   04924 Renin secretion
    101034085 (CREB1)
   04925 Aldosterone synthesis and secretion
    101034085 (CREB1)
   04927 Cortisol synthesis and secretion
    101034085 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101034085 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101034085 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    101034085 (CREB1)
   04728 Dopaminergic synapse
    101034085 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101034085 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    101034085 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    101034085 (CREB1)
   04713 Circadian entrainment
    101034085 (CREB1)
   04714 Thermogenesis
    101034085 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101034085 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101034085 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101034085 (CREB1)
   05020 Prion disease
    101034085 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    101034085 (CREB1)
   05031 Amphetamine addiction
    101034085 (CREB1)
   05034 Alcoholism
    101034085 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101034085 (CREB1)
   04934 Cushing syndrome
    101034085 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101034085 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034085 (CREB1)
   05161 Hepatitis B
    101034085 (CREB1)
   05163 Human cytomegalovirus infection
    101034085 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034085 (CREB1)
   05165 Human papillomavirus infection
    101034085 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101034085 (CREB1)
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101034085 (CREB1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101034085 (CREB1)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    101034085 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 101034085
NCBI-ProteinID: XP_003925656
UniProt: A0A2K6UVG1
LinkDB
Position
Unknown
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQTAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcctaccgtaactctagtacagctgcctaat
gggcagacagttcaagtccatggagttattcagacggcccagccatcagttattcagtct
ccacaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggaatcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagact
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccagactagcagtgga
cagtacattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gttcagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacaaacataccagattcgcacagcacccactagc
actattgctcctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcgcgaaagagagaggtccgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034435
Entry
101034435         CDS       T04350                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04137  Mitophagy - animal
sbq04141  Protein processing in endoplasmic reticulum
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04720  Long-term potentiation
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04932  Non-alcoholic fatty liver disease
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101034435 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101034435 (ATF4)
   04668 TNF signaling pathway
    101034435 (ATF4)
   04022 cGMP-PKG signaling pathway
    101034435 (ATF4)
   04151 PI3K-Akt signaling pathway
    101034435 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101034435 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    101034435 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101034435 (ATF4)
   04922 Glucagon signaling pathway
    101034435 (ATF4)
   04912 GnRH signaling pathway
    101034435 (ATF4)
   04915 Estrogen signaling pathway
    101034435 (ATF4)
   04926 Relaxin signaling pathway
    101034435 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    101034435 (ATF4)
   04918 Thyroid hormone synthesis
    101034435 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    101034435 (ATF4)
   04925 Aldosterone synthesis and secretion
    101034435 (ATF4)
   04927 Cortisol synthesis and secretion
    101034435 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101034435 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    101034435 (ATF4)
   04728 Dopaminergic synapse
    101034435 (ATF4)
   04720 Long-term potentiation
    101034435 (ATF4)
   04722 Neurotrophin signaling pathway
    101034435 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    101034435 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101034435 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101034435 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101034435 (ATF4)
   05012 Parkinson disease
    101034435 (ATF4)
   05014 Amyotrophic lateral sclerosis
    101034435 (ATF4)
   05020 Prion disease
    101034435 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    101034435 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    101034435 (ATF4)
   05031 Amphetamine addiction
    101034435 (ATF4)
   05034 Alcoholism
    101034435 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101034435 (ATF4)
   04934 Cushing syndrome
    101034435 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034435 (ATF4)
   05161 Hepatitis B
    101034435 (ATF4)
   05163 Human cytomegalovirus infection
    101034435 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101034435 (ATF4)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101034435 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4407 Nop53 Laminin_II AAA_13 bZIP_Maf
Other DBs
NCBI-GeneID: 101034435
NCBI-ProteinID: XP_010341884
LinkDB
Position
Unknown
AA seq 334 aa
MTEMSFLSSEVLEGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSAPNNGKEDAFSGTDWMLEKMDLNEFDFDALLRVDDLETMTDEFLATLDDTC
DLFAPLVQETNKEPPQAVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSTTPDHSFSL
ELGSEVDISEGDRKPDSTAYIAMICMSPESYLGSPQHSPSARGSPNRSLPSPGVLCDSGR
PKPYDPPGEKMVAANVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKN
EALKERADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgagcagcgaggtgttggagggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaggaaagcctaggtctcttagatgactacctggaggtg
gccaagcatttcaaacctcatgggttctccagcgacaaggctaaggcgggctcctccgaa
tggctggctgtggatgggttggtcagtgcccccaacaacggcaaggaggatgctttctcc
gggacagattggatgttggagaaaatggatctgaacgagtttgactttgatgccctgttg
cgtgtagatgacctggaaaccatgacagatgagtttttggccacgttggacgacacgtgt
gatctctttgcccccctagtccaggagactaataaggagcccccccaggcggtgaaccca
attggccatctcccagaaagtttaacaaaacccgaccaggttgcccctttcaccttcttg
caacctcttcccctatccccaggggtcctctccaccactccagatcattcctttagttta
gagctgggcagtgaagtggatatctctgaaggagataggaagccagactccactgcttat
attgccatgatctgtatgagcccagagtcctatctgggttctccccagcatagcccctct
gccaggggctccccaaataggagcctcccatctccaggtgttctttgtgactctggccgc
cccaaaccttatgaccctcctggagagaaaatggtagcagcgaatgtaaagggtgagaaa
ctggataagaaattgaaaaagatggagcaaaacaagacagcagccactaggtaccgccag
aagaagagggcagagcaggaggccctcactggtgagtgcaaggagctggaaaagaagaat
gaggctctaaaagagagggcagattccttggccaaggagatccagtacctgaaagatctg
atagaagaggtccgaaaggcaagggggaagaaaagggtcccttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035834
Entry
101035834         CDS       T04350                                 

Gene name
ATF2
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-2 isoform X1
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04714  Thermogenesis
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101035834 (ATF2)
   04668 TNF signaling pathway
    101035834 (ATF2)
   04022 cGMP-PKG signaling pathway
    101035834 (ATF2)
   04151 PI3K-Akt signaling pathway
    101035834 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101035834 (ATF2)
   04922 Glucagon signaling pathway
    101035834 (ATF2)
   04915 Estrogen signaling pathway
    101035834 (ATF2)
   04926 Relaxin signaling pathway
    101035834 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    101035834 (ATF2)
   04918 Thyroid hormone synthesis
    101035834 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    101035834 (ATF2)
   04925 Aldosterone synthesis and secretion
    101035834 (ATF2)
   04927 Cortisol synthesis and secretion
    101035834 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101035834 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    101035834 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    101035834 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101035834 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101035834 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    101035834 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    101035834 (ATF2)
   05031 Amphetamine addiction
    101035834 (ATF2)
   05034 Alcoholism
    101035834 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101035834 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101035834 (ATF2)
   05161 Hepatitis B
    101035834 (ATF2)
   05163 Human cytomegalovirus infection
    101035834 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101035834 (ATF2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101035834 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 101035834
NCBI-ProteinID: XP_010350147
UniProt: A0A2K6TED0
LinkDB
Position
Unknown
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcgcctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcttca
gaagacgacatcaaaaaaatgcctctagatttatcccctcttgcaacacctatcataaga
agcaaaattgaggagccttctgttgtggaaacaactcaccaggatagtcctttacctcat
ccagagtctactaccagtgatgagaaggaagtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtcattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctctaacaggccaattgtccctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttccagctgcagtcccactcgttcgaccagtcaccatggtgcctagtgttccagga
atcccaggtccttcctctccccaaccagtacagtccgaagcaaaaatgagattaaaagct
gctttgacccagcaacatcccccagttaccaatggtgatactgtcaaaggtcatggtagt
ggattggttaggactcagtcagaggaatctcgaccacagtcattacaacagccagcgaca
tccactacagaaactccggcttctccagctcacacaactccacagactcaaagtacaagt
ggtcgtcggagaagagcagctaatgaagatcctgatgaaaaaaggagaaagttcttagag
cgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtgtgggttcagtcttta
gagaagaaagcagaagacttgagttcattaaatggtcaactgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
actgccatgcagaagaaatctggctatcatactgctgataaagacgatagttcagaagac
atttcagtgccgagtagtccacatacagaagctatacagcatagttcggtcagcacatcc
aatggagtcagttcaacctccaaggcagaagctgtagccacatcagtcctcacccagatg
gcggaccagagtacagagcctgctctttcacagatcgttatggctccttcctcccagtca
cagccctcaggaagttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036473
Entry
101036473         CDS       T04350                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04714  Thermogenesis
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04931  Insulin resistance
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04962  Vasopressin-regulated water reabsorption
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101036473 (CREB3L3)
   04024 cAMP signaling pathway
    101036473 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    101036473 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    101036473 (CREB3L3)
   04152 AMPK signaling pathway
    101036473 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101036473 (CREB3L3)
   04922 Glucagon signaling pathway
    101036473 (CREB3L3)
   04915 Estrogen signaling pathway
    101036473 (CREB3L3)
   04926 Relaxin signaling pathway
    101036473 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    101036473 (CREB3L3)
   04918 Thyroid hormone synthesis
    101036473 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    101036473 (CREB3L3)
   04916 Melanogenesis
    101036473 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    101036473 (CREB3L3)
   04927 Cortisol synthesis and secretion
    101036473 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101036473 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101036473 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    101036473 (CREB3L3)
   04728 Dopaminergic synapse
    101036473 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    101036473 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101036473 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101036473 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101036473 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101036473 (CREB3L3)
   05020 Prion disease
    101036473 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    101036473 (CREB3L3)
   05031 Amphetamine addiction
    101036473 (CREB3L3)
   05034 Alcoholism
    101036473 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101036473 (CREB3L3)
   04934 Cushing syndrome
    101036473 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101036473 (CREB3L3)
   05161 Hepatitis B
    101036473 (CREB3L3)
   05163 Human cytomegalovirus infection
    101036473 (CREB3L3)
   05165 Human papillomavirus infection
    101036473 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101036473 (CREB3L3)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101036473 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf pEK499_p136 DUF1664
Other DBs
NCBI-GeneID: 101036473
NCBI-ProteinID: XP_003938859
UniProt: A0A2K6SUP9
LinkDB
Position
Unknown
AA seq 467 aa
MELDGPMNENLAAGKMASSACPMDPIDSFELLDLLFDRQDGVLRHVELGEGWGCVKDQQV
LPNPDPDDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPPDTPPRIGPAASPAGGH
PAQPGKGPCLSYHPGTSCPTTPPGPVVQVPEASVTIDLEMWSPGGRIYAEKQAEPVGLSP
RCNLTVKDLLLSGSSGDLQQHQLGAPHLLRPVAGHCQELVLTEDEKKLLVKEGITLPIQL
PLTKYEERALKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEK
QNLSLLEQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFASNKAKSPGDFA
PVRVFSRTLHNDAASRVAPDALLGSEAPGPRPEADKPKEGSPGSPRAAWGFRDTADLTNS
MEELDNASLVLRNKTEGLGEVALLDWVAPGPSTGSGRAGLEAAGDEL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggaactggatggacccatgaatgagaatttagctgcaggaaagatggcttcttctgcc
tgccccatggaccccatcgatagctttgagctcctggatctcctgtttgaccggcaggat
ggcgtcctgagacatgtggagctgggcgagggctggggctgcgtcaaagaccagcaggtc
ctgccaaaccccgaccctgatgacttcctcagctccatcctgggctctggagactcactg
cccagctccccactctggtcccctgaaggcagcgatagtggcatctctgaagacctccca
tctgaccccccagacacccctccacgcatcggaccagccgcctccccagccggcggccat
cctgcccagcctggcaaggggccctgcctctcatatcatcctggcacctcctgccccacc
acacccccggggccagtggtccaagtgcctgaagcctctgtgaccatagacctggaaatg
tggagccctggaggaaggatctatgctgagaagcaggctgaaccggtgggcctgtcacca
cgatgcaatctcacggtgaaagatctgctgctttcgggcagcagcggggacctgcaacag
catcaactgggagccccccacctgctgcgacctgtggccgggcactgtcaggagctggtg
ctgaccgaggatgagaagaagctgctggtgaaagaaggcatcaccctgcccatccagctg
ccgctcacgaagtatgaggagcgagcgctgaaaaaaatccgccggaaaatccggaacaag
cagtccgcccaagaaagcaggaagaagaagaaggaatatatcgacggcttggagactcgg
atgtcagcttgcactgctcagaatcaggagttacagaggaaggtcttgcatcttgagaag
caaaatctgtccctcttggagcagctgaagaaactccaggccatcgtggtgcagtccacc
agcaagtcagcccagacagggacctgtgttgcggtcctgctactgtccttcgccctcatc
atcctcccctccatcagcccttttgcctccaacaaagccaagagccctggggactttgcg
cctgtgcgagtcttctccagaactttgcacaatgatgctgcctcccgcgtggcccctgat
gctctgctgggctctgaggcccctggaccccgacctgaggctgacaaacccaaagaaggg
tctccaggcagccccagggcagcctggggcttccgggacaccgcggacctgaccaattcg
atggaggagctggacaatgccagcctggtcctgaggaacaagacggaggggctgggcgag
gtcgccctgctagactgggtggcacccgggccaagcactggctccggacgtgcagggctg
gaggcggcgggggatgagctgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041199
Entry
101041199         CDS       T04350                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04714  Thermogenesis
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04931  Insulin resistance
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04962  Vasopressin-regulated water reabsorption
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101041199 (CREB3L4)
   04024 cAMP signaling pathway
    101041199 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    101041199 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    101041199 (CREB3L4)
   04152 AMPK signaling pathway
    101041199 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101041199 (CREB3L4)
   04922 Glucagon signaling pathway
    101041199 (CREB3L4)
   04915 Estrogen signaling pathway
    101041199 (CREB3L4)
   04926 Relaxin signaling pathway
    101041199 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    101041199 (CREB3L4)
   04918 Thyroid hormone synthesis
    101041199 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    101041199 (CREB3L4)
   04916 Melanogenesis
    101041199 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    101041199 (CREB3L4)
   04927 Cortisol synthesis and secretion
    101041199 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101041199 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101041199 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    101041199 (CREB3L4)
   04728 Dopaminergic synapse
    101041199 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    101041199 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101041199 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101041199 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    101041199 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101041199 (CREB3L4)
   05020 Prion disease
    101041199 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    101041199 (CREB3L4)
   05031 Amphetamine addiction
    101041199 (CREB3L4)
   05034 Alcoholism
    101041199 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101041199 (CREB3L4)
   04934 Cushing syndrome
    101041199 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101041199 (CREB3L4)
   05161 Hepatitis B
    101041199 (CREB3L4)
   05163 Human cytomegalovirus infection
    101041199 (CREB3L4)
   05165 Human papillomavirus infection
    101041199 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101041199 (CREB3L4)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101041199 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB HAUS-augmin3 JMY DUF4200 HALZ KASH_CCD YabA DUF1664 ADIP
Other DBs
NCBI-GeneID: 101041199
NCBI-ProteinID: XP_003941914
LinkDB
Position
Unknown
AA seq 394 aa
MDLGIPDLLDTWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSSGDHSCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCRPDSPPAPRATSSPALFEVVYEAG
ALGKMQEEAGPNVGLISIQLDQWSPAFMVPDACMVSELPFDAHAHILPRAGTVAPVPCTT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQMLIAQTSNKAAQTSTCVLI
LFSLALIILPSFSPFQGRPEAGPEDYQPHGVTSRNILTHKDVTENLETQVAESRLREPPG
AKDANASARTLAEKMGGKPRPSGHIGNMLHADEM
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggatctcggaatccctgacctgctggacacgtggctggagcccccagaggatatcttc
tcaacaggatctgtcctggagctgggactccactgccctcctccagaggttccagtgact
aggctacaagaacaaggattgcaaggctggaagtccagtggggaccatagctgtggcctt
caagagagtgagcctgaagatttcctgaagcttttcattgatcccaatgaggtatactgc
tcagaagcatctcctggcagtgacagtggcatctctgaggacccctgccgtccagacagt
cctcctgcccccagagcaaccagttctcctgccctctttgaggttgtctatgaggcaggg
gccctggggaagatgcaggaggaagctgggccaaatgtaggcctcatctccatccagcta
gatcagtggagcccagcatttatggtgcctgatgcctgcatggtcagtgagctgcccttt
gatgctcatgcccacatcctgcccagagcaggcaccgtagccccagtgccttgtacaacc
ctgctgccctgtcaaaccctgttcctgacagatgaggagaagcgtctgctggggcaggaa
ggggtttctctgccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtctgctcaggacagtcggcggcggaagaaggag
tacattgatgggctggagagcagggtggcagcctgttctgcacagaaccaagaattacag
aaaaaagtccaggagctggagaggcacaacatctccttggtagctcagctccgccagctg
cagatgctaattgctcaaacttccaacaaagctgctcagaccagcacttgtgttctgatt
cttttttccctggctctcatcatcctgcccagcttcagtccattccagggtcgaccagaa
gctgggcctgaggattaccagcctcacggagtgacttccagaaatatcctgacccacaag
gatgtaacagaaaatctggagacccaagtggcagagtccagactgagggagccacctgga
gccaaggatgcaaatgcctcagcgaggacactggctgagaagatgggagggaagccaaga
cccagtgggcacattgggaacatgctgcatgcagatgagatgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042795
Entry
101042795         CDS       T04350                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04714  Thermogenesis
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04931  Insulin resistance
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04962  Vasopressin-regulated water reabsorption
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101042795 (CREB3L2)
   04024 cAMP signaling pathway
    101042795 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    101042795 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    101042795 (CREB3L2)
   04152 AMPK signaling pathway
    101042795 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101042795 (CREB3L2)
   04922 Glucagon signaling pathway
    101042795 (CREB3L2)
   04915 Estrogen signaling pathway
    101042795 (CREB3L2)
   04926 Relaxin signaling pathway
    101042795 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    101042795 (CREB3L2)
   04918 Thyroid hormone synthesis
    101042795 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    101042795 (CREB3L2)
   04916 Melanogenesis
    101042795 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    101042795 (CREB3L2)
   04927 Cortisol synthesis and secretion
    101042795 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101042795 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101042795 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    101042795 (CREB3L2)
   04728 Dopaminergic synapse
    101042795 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    101042795 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101042795 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101042795 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    101042795 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101042795 (CREB3L2)
   05020 Prion disease
    101042795 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    101042795 (CREB3L2)
   05031 Amphetamine addiction
    101042795 (CREB3L2)
   05034 Alcoholism
    101042795 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101042795 (CREB3L2)
   04934 Cushing syndrome
    101042795 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101042795 (CREB3L2)
   05161 Hepatitis B
    101042795 (CREB3L2)
   05163 Human cytomegalovirus infection
    101042795 (CREB3L2)
   05165 Human papillomavirus infection
    101042795 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101042795 (CREB3L2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101042795 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 101042795
NCBI-ProteinID: XP_003929795
UniProt: A0A2K6SD45
LinkDB
Position
Unknown
AA seq 520 aa
MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEARAQSPFTHITTSDSFNDDEVESEKWYLSTDF
PSTTIKTEPITDEPPSGLVPSVTLTITAISTPFEKEEPPLEMNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPCLHPFSLPQTHSPSRAAP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYT
ASVVRSRNLLIYEEHSPPEEPSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISN
ETSLEKSVLLELQQHLVGAKLEGNETLKVVELDRRVNTTF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagggcgtgctgcagtgggaccgcaagctgagcgag
ttgtcagagcccggggacggcgaggccctcatgtaccacacgcacttctcagaacttctg
gatgagttttcccagaacgtcttgggtcagctcctgaatgaccctttcctctcggagaag
agtgtgtcaatggaggtggaaccttccccgacgtccccggcacctctcatccaggctgag
cacagctactccctgtgcgaggaggctcgggcccagtcgcccttcacccacattaccacc
agtgacagcttcaatgacgacgaggtggaaagtgagaagtggtacctgtctacagacttc
ccttcaacaaccatcaagacagagcccattacagatgaaccaccttccggactcgttcca
tctgtcactctgaccatcacagccatctctaccccgtttgaaaaggaggaaccccctctg
gaaatgaatactggggttgactcctcgtgccagaccattattcctaaaataaagctggag
cctcacgaagtggatcagtttctaaacttctctcctaaagaagccccagtggatcacctg
catttgccgcccactcccccaagcagtcacggcagcgactcggaaggcagcctgagtccc
aacccatgcctgcaccccttcagcctgcctcaaacccacagcccctccagagccgcaccc
cgggccccctccgccctctccagctcccctctcctcacggctcctcataaactgcaggga
tcaggccctctggtcctgacggaggaggagaagaggaccctgattgctgagggctatccc
atccctaccaaattgcccctgacaaaatcagaggagaaggccctgaagaaaattcggagg
aagatcaagaataagatttctgcccaggaaagtaggagaaagaagaaagaatacatggac
agcctggagaaaaaagtggagtcttgttcaactgagaacttggaacttcggaagaaggta
gaggttctagagaacactaacaggactctccttcagcaactccagaagcttcagactttg
gtgatgggcaaggtttctcgaacctgcaagttagctggcactcagactggcacctgcctc
atggttgttgtgctgtgctttgccgttgcattcggcagcttctttcagggctacgggccc
tatccttctgccaccaagatggctctgcctagccagcattccctgcaagagccctacaca
gcctccgtggtgagatccaggaacctgctgatctacgaggagcattctcccccagaggag
ccgtccagccctggctcggctggcgagctggggggctgggatagaggttcctccctgctc
agggtgtcagggctggagtccaggccagatgtggatcttccccatttcattatctcgaat
gagaccagcctggagaagtcagtgctcttggagctgcagcagcacctggtcggcgccaaa
ctggaggggaatgaaacactaaaagttgtagaactcgacagaagagtgaataccactttc
taa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044974
Entry
101044974         CDS       T04350                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04714  Thermogenesis
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04931  Insulin resistance
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04962  Vasopressin-regulated water reabsorption
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101044974 (CREB3L1)
   04024 cAMP signaling pathway
    101044974 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    101044974 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    101044974 (CREB3L1)
   04152 AMPK signaling pathway
    101044974 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101044974 (CREB3L1)
   04922 Glucagon signaling pathway
    101044974 (CREB3L1)
   04915 Estrogen signaling pathway
    101044974 (CREB3L1)
   04926 Relaxin signaling pathway
    101044974 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    101044974 (CREB3L1)
   04918 Thyroid hormone synthesis
    101044974 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    101044974 (CREB3L1)
   04916 Melanogenesis
    101044974 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    101044974 (CREB3L1)
   04927 Cortisol synthesis and secretion
    101044974 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101044974 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101044974 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    101044974 (CREB3L1)
   04728 Dopaminergic synapse
    101044974 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    101044974 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101044974 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101044974 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101044974 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101044974 (CREB3L1)
   05020 Prion disease
    101044974 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    101044974 (CREB3L1)
   05031 Amphetamine addiction
    101044974 (CREB3L1)
   05034 Alcoholism
    101044974 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101044974 (CREB3L1)
   04934 Cushing syndrome
    101044974 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101044974 (CREB3L1)
   05161 Hepatitis B
    101044974 (CREB3L1)
   05163 Human cytomegalovirus infection
    101044974 (CREB3L1)
   05165 Human papillomavirus infection
    101044974 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101044974 (CREB3L1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101044974 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N Prominin TPR_MLP1_2 APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 101044974
NCBI-ProteinID: XP_003920080
UniProt: A0A2K6TLG0
LinkDB
Position
Unknown
AA seq 519 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALG
HKLCSIMVKQEQSPELPVDPLAAPTAMAATATMATTPLLGLSPLSRLPIPHQAPGEMTQL
PVIKAEPPEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPHSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMAADSIYTASQM
PSRSLLFYDDGAGSWEDGRSTLLPMEPPDGWEINPGGPAEQRPQDHLQHDHLDSTHETTK
YLSEAWPKDAGNGTSPDFSHSKEWFHDRDLGPNTTIKLS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacgctgtcttggaacccttcccggccgacaggctgttccccggatccagcttcctg
gacttaggggatctgaacgagtcggacttccttaacaatgcgcactttcctgagcacctg
gaccacttcgcggagaatatggaggacttctccaacgacctgttcagcagtttctttgat
gaccctgtgctggatgagaagagccctctattggacatggaactggactccccaacacca
ggcatccaggcggagcacagctactccctgagcggagactcagcgccccagagccccctg
gtgcccatcaagatggaggacaccacccaagatgcagagcatggagcatgggcgctggga
cacaaactgtgctccatcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgcccccactgccatggctgccacggccaccatggccaccaccccgctgctgggc
ctcagccccctgtccaggctgcccatcccccaccaggccccaggagagatgactcagctg
ccagtgatcaaggcagagcctccggaggtgaaccagttcctcaaagtgacaccagaggac
ctggtgcagatgcctccgacgccccccagcagccacggcagcgacagcgacggctcccag
agtccccactctctgcccccttccagccctgtccggcctatggcgcgctcctccacagcc
atctccacctccccactcctcactgccccccacaaactacagggcacctcagggccactg
ctcctgactgaggaggagaagcggaccctgattgctgagggctaccccatccccacgaaa
ctccccctcaccaaagccgaggagaaggccttgaagagagtccggaggaaaatcaagaac
aagatctcggcccaggagagccgtcgtaagaagaaggagtatgtggagtgtctagaaaag
aaggtggagacatttacatcagagaacaatgaactgtggaagaaggtggagaccctggag
aatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaacaag
atctccagaccttacaagatggctgccacccagactgggacctgcctcatggtggcagcc
ttgtgctttgttctggtgctgggctccctcgtgccctgccttcccgagttctcctccggc
tcccagactgtgaaggaagaccccatggctgcagacagcatctacacggccagccagatg
ccctcccgaagcctcctgttctacgatgacggggcgggctcgtgggaagatggccgcagc
accctgctgcccatggaacccccagatggctgggaaatcaaccccggggggccggcggag
cagcgaccccaggaccacctgcagcatgatcacctggacagcacccacgagaccaccaag
tacctgagtgaggcctggcccaaagacgctggaaacggcaccagccccgacttctcccac
tccaaggagtggttccatgacagggatctgggccccaacaccaccatcaaactctcctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047355
Entry
101047355         CDS       T04350                                 

Gene name
ATF6B
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04141  Protein processing in endoplasmic reticulum
sbq04151  PI3K-Akt signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04918  Thyroid hormone synthesis
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101047355 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101047355 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101047355 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101047355 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101047355 (ATF6B)
   04915 Estrogen signaling pathway
    101047355 (ATF6B)
   04926 Relaxin signaling pathway
    101047355 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101047355 (ATF6B)
   04918 Thyroid hormone synthesis
    101047355 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101047355 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101047355 (ATF6B)
   04927 Cortisol synthesis and secretion
    101047355 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101047355 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101047355 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101047355 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101047355 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101047355 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101047355 (ATF6B)
   05031 Amphetamine addiction
    101047355 (ATF6B)
   05034 Alcoholism
    101047355 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101047355 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047355 (ATF6B)
   05161 Hepatitis B
    101047355 (ATF6B)
   05163 Human cytomegalovirus infection
    101047355 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101047355 (ATF6B)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101047355 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 101047355
NCBI-ProteinID: XP_010330544
LinkDB
Position
Unknown
AA seq 710 aa
MVGGWGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQTQLFRCPEQD
VPFDGSSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTESSSQA
LGVGEVLHVKTESLAPPLCLLGDDPASSFETVQINVGLISDDSSDVQTKIEPVSPCSSIN
SEASLLSADSSSQAFIGEEVLEVKTESPSPSGCLLWDVPAPSLGAVQISMGPSPDGSSGK
ALPTRKPPLQPKPVVLTTVPMPPRTVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGP
APSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLADNQQLRRENAALRRRLEALLAENSELKLGTGNRKVVCIMVFLLFIAFNFGPVS
ISEPPSAPVSPRVNKGEPRPRRHLLEFSEPVHGVEPLQGSSHGPEEPQPSPADQPSFRXG
AREDPSSFKGXTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
KAQERQKSQPRKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFY
VVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTR
VIHIKTSTVPPSLRKQPSPAPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagtgagattgcggac
ccgacgcgtttcttcaccgacaacctgctgagcccggaggactgggacagcaccttgtat
tctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccggagcaggat
gtcccgtttgacggcagttccctggacgtggggatggatgtcagcccccctgagccccca
tgggaactcctgcccatctttccagatcttcaggtgaagtctgagccatcttccccctgc
tcttcctcctccctcagctcggaatcatcacatctctccacagaatcctccagccaggct
cttggggtaggagaggtgctccacgtgaagacagagtccttggcacccccactctgtctc
ctgggagatgacccagcatcctcgtttgaaaccgtccagatcaatgtaggcctcatctct
gatgattcctcagatgtccagaccaagatagaacctgtctctccatgttcctccatcaac
tctgaggcctccctgctctcagccgactcctccagccaggcttttataggagaggaggtc
ctggaagtgaagacagagtccccatccccttcagggtgcctcctgtgggatgtcccagcc
ccctcacttggagctgtccagatcagcatgggcccatcccctgatggctcctcagggaaa
gccctgcccacccggaagccgccactgcagcccaaacctgtggtgctaaccaccgtcccg
atgccacccagaactgtgcctcccagcaccactgttcttctgcagcctctcgtccagcca
cccccagtgtccccagttgtccttatccagggtgctattcgagtccagcctgaagggccg
gctccctctcttccacggcccgagaggaagagcatcgttcctgctcctatgcctggcaac
tcctgccctcctgaagtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaac
agggagtcagcctgccagtcccggagaaagaagaaagagtatctgcaggggctggaggct
cggctgcaggcagtactggctgacaaccagcagctccgccgggagaatgctgccctccgg
cggcggctggaggccctgctggctgaaaacagcgagctcaagttaggaactggaaacagg
aaggtggtctgcatcatggtcttccttctcttcatcgccttcaactttggacctgtcagc
atcagtgagcctccttcagctcccgtctctcctcgggtgaacaagggggagcctcgaccc
cggagacacttgctggagttctcagagccagttcacggagttgaacctctccaggggtcc
tcccatggccctgaagagccccagcccagccccgcagaccagcccagtttcaggtgagga
gcgagagaggacccctcctcctttaagggnnncaccaaggagttactactgagagaccta
gaccagctcttcctctcctctgattgccggcatttcaaccgaaccgagtccctgaggctt
gctgacgagctcagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
aaggcccaggagagacagaagtctcagccacggaagtcacctccagttaaggcagtcccc
atccaaccccctggacccccagaaagggattctgtgggccaactgcagctatatcgccac
ccagaccgttcacagccagcgttcttggatgcaattgaccggcgggaagacacattttat
gttgtctctttccgaagggatcacctgctgctcccagccatcagccacaacaagacctcc
cggcccaagatgtctctggtgatgcctgccatggcccccaatgagaccttgtcaggccgt
ggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagg
gtgatccacatcaagacctccacggtgcccccctcgctccgaaaacagccgtcccccgcc
ccgggcaatgccacaggtggccccttgccagcctctgcagccagccaggcccaccaggcc
tctcaccagcccctctacctcaatcatccctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052885
Entry
101052885         CDS       T04350                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04714  Thermogenesis
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04931  Insulin resistance
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04962  Vasopressin-regulated water reabsorption
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101052885 (CREB3)
   04024 cAMP signaling pathway
    101052885 (CREB3)
   04022 cGMP-PKG signaling pathway
    101052885 (CREB3)
   04151 PI3K-Akt signaling pathway
    101052885 (CREB3)
   04152 AMPK signaling pathway
    101052885 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101052885 (CREB3)
   04922 Glucagon signaling pathway
    101052885 (CREB3)
   04915 Estrogen signaling pathway
    101052885 (CREB3)
   04926 Relaxin signaling pathway
    101052885 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    101052885 (CREB3)
   04918 Thyroid hormone synthesis
    101052885 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    101052885 (CREB3)
   04916 Melanogenesis
    101052885 (CREB3)
   04925 Aldosterone synthesis and secretion
    101052885 (CREB3)
   04927 Cortisol synthesis and secretion
    101052885 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101052885 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101052885 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    101052885 (CREB3)
   04728 Dopaminergic synapse
    101052885 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    101052885 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101052885 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101052885 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    101052885 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101052885 (CREB3)
   05020 Prion disease
    101052885 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    101052885 (CREB3)
   05031 Amphetamine addiction
    101052885 (CREB3)
   05034 Alcoholism
    101052885 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101052885 (CREB3)
   04934 Cushing syndrome
    101052885 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101052885 (CREB3)
   05161 Hepatitis B
    101052885 (CREB3)
   05163 Human cytomegalovirus infection
    101052885 (CREB3)
   05165 Human papillomavirus infection
    101052885 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101052885 (CREB3)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101052885 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 101052885
NCBI-ProteinID: XP_003943849
LinkDB
Position
Unknown
AA seq 374 aa
MSQMELGLNPGDQDLLGFLLEESGDLGTAYDEAVRAPLDWELPLSEVPSDWEVDDLLSSL
LSPPASLNVLSSSNPCLVHHDHTYSLPQEAVSVDLESESFGKEETQMTPQHMEEMAEQET
VRLILTDEEKGLLEKEGLILPETLPLTKMEEQILKRVRRKIRNKRSAQESRRKKKVYVGG
LESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIKISNKTSSSSTCVLVLLFS
FCLLLVPAMYSSDTRGSLPAEHGVLSRQLREVPSEDPYQLELPTLQSEVLKDSTHQWLDG
SDHVLQVPGNSSCLLYYMSQALRTEPLLEWLFPDLFSEPLCHGPILLLQANLTRKGGGLP
THSPSVILQDRYSG
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcccaaatggagctaggattgaatcctggtgaccaagacctgctgggcttcctgcta
gaggaaagtggagatttggggacggcgtacgatgaggccgtgagggccccactggactgg
gagctgccgctgtcagaggtaccgagtgactgggaggtggatgatttgctgagctcactg
ctgagtcccccagcatcgttgaacgttctcagctcctccaacccctgccttgttcaccac
gaccacacctactccctcccacaggaagctgtctctgtggatctagagagtgagagcttt
ggaaaagaagagacccagatgactccacagcatatggaggaaatggcagagcaggagacg
gttaggttgatactgacagatgaggagaagggtctattggagaaggaggggcttattctg
cctgagacacttcctctcactaagatggaggaacaaattctgaaacgtgtgcgaaggaag
attcgaaataaaagatctgctcaagaaagccgcaggaagaagaaggtgtatgttgggggt
ttagagagcagggtcttgaaatacacagcccagaatatggagcttcagaacaaagtacag
cttctggaggaacagaatttgtctcttctagatcaactgaggaaactccaggccatggtg
attaagatatcaaacaaaaccagcagcagcagcacctgtgtcttggtcctactattctcc
ttctgcctcctccttgtacctgctatgtactcctctgacacaagagggagcctgccagct
gagcatggagtgttgtcccgccagcttcgtgaggtccccagtgaggacccttaccagctg
gagctgcctaccctgcagtcagaggtgctgaaagacagcacacaccagtggctggacggc
tcagaccatgtactccaggtccctggcaactcttcctgcctgctgtactacatgtctcag
gctctcaggacagagcctctcctggagtggctattccctgacctcttctcggagcctctc
tgccacggtcccatactccttctgcaggcaaatctcacaagaaaggggggagggcttccc
acccatagcccctctgtcatcttgcaggacagatactcaggctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054090
Entry
101054090         CDS       T04350                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04668  TNF signaling pathway
sbq04714  Thermogenesis
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04911  Insulin secretion
sbq04915  Estrogen signaling pathway
sbq04918  Thyroid hormone synthesis
sbq04922  Glucagon signaling pathway
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04931  Insulin resistance
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04962  Vasopressin-regulated water reabsorption
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05034  Alcoholism
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05203  Viral carcinogenesis
sbq05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101054090 (CREB5)
   04024 cAMP signaling pathway
    101054090 (CREB5)
   04022 cGMP-PKG signaling pathway
    101054090 (CREB5)
   04151 PI3K-Akt signaling pathway
    101054090 (CREB5)
   04152 AMPK signaling pathway
    101054090 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101054090 (CREB5)
   04922 Glucagon signaling pathway
    101054090 (CREB5)
   04915 Estrogen signaling pathway
    101054090 (CREB5)
   04926 Relaxin signaling pathway
    101054090 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    101054090 (CREB5)
   04918 Thyroid hormone synthesis
    101054090 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    101054090 (CREB5)
   04925 Aldosterone synthesis and secretion
    101054090 (CREB5)
   04927 Cortisol synthesis and secretion
    101054090 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101054090 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101054090 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    101054090 (CREB5)
   04728 Dopaminergic synapse
    101054090 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    101054090 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101054090 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101054090 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    101054090 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101054090 (CREB5)
   05020 Prion disease
    101054090 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    101054090 (CREB5)
   05031 Amphetamine addiction
    101054090 (CREB5)
   05034 Alcoholism
    101054090 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101054090 (CREB5)
   04934 Cushing syndrome
    101054090 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101054090 (CREB5)
   05161 Hepatitis B
    101054090 (CREB5)
   05163 Human cytomegalovirus infection
    101054090 (CREB5)
   05165 Human papillomavirus infection
    101054090 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101054090 (CREB5)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    101054090 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11 DivIC
Other DBs
NCBI-GeneID: 101054090
NCBI-ProteinID: XP_003935211
UniProt: A0A2K6SEX3
LinkDB
Position
Unknown
AA seq 508 aa
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGAHQLSSA
RLPNHDTSVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMDMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTSNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSASEVVGSSTLSQLATHRTDLNPIL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgatttatgaggaatccaagatgaatttggagcaagagaggccatttgtctgcagtgcc
ccaggctgctcccagcgcttcccaacagaggatcatctgatgattcataggcacaagcat
gaaatgactttgaagtttccttcaataaaaacagacaacatgttatcagatcaaactccg
accccaacgagattcctgaagaactgtgaggaagtgggcctctttagcgagctggactgc
tctctggagcacgagttcaggaaggcccaggaggaggagagcagcaagcggaatatctcg
atgcataatgcagttggtggggccatgacggggcccggagctcaccagcttagcagcgct
cggctgcccaaccacgacaccagcgttgtgattcagcaagccatgccgtcgccccagtcc
agctccgtcatcactcaggcaccttccaccaaccgccagatcgggcctgtcccaggctct
ctatcttctctgctacatcttcacaacagacagagacagcccatgccagcctccatgccc
gggaccctgcctaaccctacaatgccaggatcttccgccgtcttgatgccaatggagaga
caaatgtcagtgaactccagcatcatggggatgcaaggtccaaatctcagcaacccctgc
gcttctccccaagtccagccgatgcattcagaagccaaaatgaggttgaaggctgcattg
actcaccaccctgctgccatgtcaaatgggaatatgaacaccatgggacacatgatggac
atgatgggctcccggcaggaccagacgccacaccatcacatgcactcacacccgcatcag
caccagacactgccacctcaccacccttacccacaccagcaccagcacccagcgcaccat
cctcaccctcaaccccatcaccagcagaaccatccacatcaccactcccattcccacctt
catgcacacccagcacatcaccagacctcgccacatccgcccctgcacaccagtaaccaa
gcacaggtttcaccagcaacacaacagatgcagccaacccagacaatacagccgccccaa
cccacaggggggcgccggcgaagggtggtggacgaggatcccgacgagaggcgacggaaa
tttctggaacggaaccgggcagctgccacccgctgcagacagaagaggaaggtctgggtg
atgtcattggaaaagaaagcagaagaactcacccagacaaacatgcagcttcagaatgaa
gtgtctatgttgaaaaatgaggtggcccagctgaaacagttgttgttaacacataaagac
tgcccgataacagccatgcagaaagaatcacaaggatatctaagtccggagagtagtcct
cctgcaagtcccgtcccagcttgctcccagcaacaagtcatccagcataataccatcact
acttcctcgtcggccagcgaggtggtaggaagctccaccctcagccagctcgccactcac
agaacagacctgaacccgattctttaa

DBGET integrated database retrieval system