KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034130
Entry
101034130         CDS       T04350                                 

Definition
(RefSeq) estrogen receptor
  KO
K08550  estrogen receptor alpha
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101034130
   04917 Prolactin signaling pathway
    101034130
   04919 Thyroid hormone signaling pathway
    101034130
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101034130
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034130
   05205 Proteoglycans in cancer
    101034130
  09162 Cancer: specific types
   05224 Breast cancer
    101034130
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101034130
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101034130
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101034130
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101034130
Nuclear receptors [BR:sbq03310]
 3. Estrogen like
  3A. Estrogen receptor
   101034130
SSDB
Motif
Pfam: Hormone_recep ESR1_C
Other DBs
NCBI-GeneID: 101034130
NCBI-ProteinID: XP_003933843
LinkDB
Position
Unknown
AA seq 332 aa
MLKHKRQRDDGEGRNEVGSTGDMRAANLWPSPLMIKHSKKNSPALSLTADQMVSALLDAE
PPIIYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAW
LEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGE
EFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRR
LAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTNRTGVPMEDT
DQSHLATAGSTSSHSLQKYYITGEGEGFPTTI
NT seq 999 nt   +upstreamnt  +downstreamnt
atgttgaaacacaagcgccagagagatgatggggagggcaggaatgaagtggggtccact
ggagacatgagagctgccaacctttggccaagcccgctcatgatcaagcactctaagaag
aacagcccagccttgtcactgacggccgaccagatggtcagtgccttgttggatgctgag
ccccccataatctattccgagtacgatcctacgagacccttcagtgaggcttcaatgatg
ggcttactgaccaacctggcagacagggagctggttcacatgatcaactgggcaaagagg
gtaccaggctttgtggatttgaccctccatgatcaggtccaccttctagaatgtgcctgg
ctagagatcctgatgattggtctcgtctggcgctccatggagcacccagggaaactcctg
tttgctcctaacttgctcttggacaggaaccagggaaaatgtgtagagggcatggtggag
atctttgacatgttgctggctacatcatctcggttccgcatgatgaatctgcagggagag
gagtttgtgtgcctcaaatctattattttgcttaattctggagtgtacacatttctgtcc
agcaccctgaagtctctggaagagaaggaccatatccaccgagtcctggacaagatcaca
gacactctgatccacctgatggccaaggcaggcctgaccttgcagcagcagcaccggcgg
ctggcccagctcctcctcatcctctcccacatcaggcacatgagtaacaaaggcatggag
catctgtacagcatgaagtgcaagaacgtggtacccctctatgacctgctgctggagatg
ctggacgcccaccgcctccacgcacccactaaccgcacaggggtgcccatggaggacacg
gaccaaagccacttggccactgcaggctctacttcatcgcattccttgcaaaagtattat
atcacgggggagggagagggtttccccaccacaatctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046392
Entry
101046392         CDS       T04350                                 

Gene name
ESR2
Definition
(RefSeq) estrogen receptor beta
  KO
K08551  estrogen receptor beta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04929  GnRH secretion
sbq05200  Pathways in cancer
sbq05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    101046392 (ESR2)
   04915 Estrogen signaling pathway
    101046392 (ESR2)
   04917 Prolactin signaling pathway
    101046392 (ESR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046392 (ESR2)
  09162 Cancer: specific types
   05224 Breast cancer
    101046392 (ESR2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101046392 (ESR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101046392 (ESR2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sbq03310]
    101046392 (ESR2)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101046392 (ESR2)
Nuclear receptors [BR:sbq03310]
 3. Estrogen like
  3A. Estrogen receptor
   101046392 (ESR2)
SSDB
Motif
Pfam: ERbeta_N Hormone_recep zf-C4 Fuz_longin_1
Other DBs
NCBI-GeneID: 101046392
NCBI-ProteinID: XP_010333681
LinkDB
Position
Unknown
AA seq 468 aa
MDIKNSPSSLNSPSSYNFGQSILPLEHGPIYIPSSYVESHHEYPAMTFYSPAVMNYSIPS
SVTNLEDGPGRQITSPNMLWSTSGHLSPLAVHHQLSHLYAEPQKSPWCEARSLEHTLPVS
SWEVLSVLLTRKRFNQEIVAITFSSPYSAIGHNDYICPATNQCTIDKNRRKSCQACRLRK
CYEVGMVKCGSRRERCGYRLVRRQGNADEQLRCAGKAKRSGGHVPRVRELLLSTLSPEQL
VLTLLEAEPPHVLISRPSVPFTEASMMMSLTKLADEELVHMISWAKKIPGFVELSLLDQV
RLLESCWLEVLMVGLMWRSIDHPGKLIFAPNLILDRDEGKCVEGILEVFDMLLATTSRFR
ELKLQHKEYLCVKAMVLLNSSMYPLVTTTQDAESSQKLAHLLNAVTDALVWVIAKSGVSS
QQQSVRLANLLMLLSHVRHARAEKASHSLTSFGMEDGDRLLPEATMEQ
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggatataaaaaactcaccatccagccttaattctccttcttcctacaattttggtcaa
tccatcttacccttggagcacggccctatatacataccttcctcctatgtagagagccac
catgaatatccggccatgacattctatagccctgctgtgatgaattatagcattcccagc
agtgttactaacttggaagatgggcctggtcggcagatcacaagcccaaatatgctctgg
tcaacatctgggcacctttctcctttagctgttcatcaccagttatcacatttgtatgca
gaacctcaaaagagtccctggtgtgaagcaagatcactagaacacaccttacctgtaagc
agctgggaagtgttatcagtgttgttaaccaggaagagatttaaccaagagatcgtagca
ataaccttttcttccccctactctgctataggacataatgattatatttgtccagcgaca
aatcagtgtacaattgataaaaaccggcgcaagagctgccaggcctgccgacttcggaag
tgctacgaagtgggaatggtgaagtgcggctcccggagagagagatgtgggtaccgcctt
gtgcggagacagggaaatgccgacgagcagctgcgttgcgccggcaaggccaagagaagt
ggcggtcacgtgccccgagtgcgggagctgctgctgagcaccctgagccccgagcagctg
gtgctcaccctcctggaggctgagccgccccatgtgctgatcagtcgccccagtgtgccc
ttcaccgaggcctccatgatgatgtccctgaccaagctggccgacgaggagctggtacac
atgatcagctgggccaagaagattcctggctttgtggagctcagcctgttggaccaagtg
cggctcttggagagctgctggttggaggtattaatggtggggctgatgtggcgctcaatt
gaccaccccggcaagctcatctttgctccaaatctcattctggacagggatgaggggaaa
tgcgtagaaggaattctggaagtcttcgacatgctcctggcaactacttcaaggtttcga
gagttaaaactccaacacaaagagtatctctgtgtcaaggccatggtcctgctcaattcc
agtatgtaccctctggtcacaacaacccaagatgctgagagcagccagaagctggcccac
ttactgaacgccgtgaccgatgctttggtctgggtgatcgccaagagtggcgtctcctcc
cagcagcagtccgtgcgcctggctaacctcctgatgctcctgtcccacgtcaggcacgcg
agggcagaaaaggcctctcactcactcacctcctttggaatggaagatggagatagactc
ttgcctgaagcaacgatggagcagtga

DBGET integrated database retrieval system