KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034142
Entry
101034142         CDS       T04350                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04068  FoxO signaling pathway
sbq04144  Endocytosis
sbq04218  Cellular senescence
sbq04350  TGF-beta signaling pathway
sbq04380  Osteoclast differentiation
sbq04390  Hippo signaling pathway
sbq04520  Adherens junction
sbq04659  Th17 cell differentiation
sbq04926  Relaxin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05142  Chagas disease
sbq05161  Hepatitis B
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05220  Chronic myeloid leukemia
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101034142 (TGFBR2)
   04350 TGF-beta signaling pathway
    101034142 (TGFBR2)
   04390 Hippo signaling pathway
    101034142 (TGFBR2)
   04068 FoxO signaling pathway
    101034142 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034142 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101034142 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    101034142 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101034142 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101034142 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101034142 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101034142 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034142 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    101034142 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101034142 (TGFBR2)
   05212 Pancreatic cancer
    101034142 (TGFBR2)
   05225 Hepatocellular carcinoma
    101034142 (TGFBR2)
   05226 Gastric cancer
    101034142 (TGFBR2)
   05220 Chronic myeloid leukemia
    101034142 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101034142 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034142 (TGFBR2)
   05161 Hepatitis B
    101034142 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101034142 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101034142 (TGFBR2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101034142 (TGFBR2)
Protein kinases [BR:sbq01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101034142 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101034142
NCBI-ProteinID: XP_003936113
UniProt: A0A2K6USC3
LinkDB
Position
Unknown
AA seq 568 aa
MGRGLLRGLWPLHIVLWTRIASTIPPQVPKSVNNDMMVTDNNGAVKLPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPRLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSEECNDNIIFSEDYNTSNPDLLLVIFQVTGVSLLPPLAIAV
SVIIIFYCYRVNRQQKLSSSWETTKPRKLMEFSSEHCAIILEDDRSDISSTCANNINHNT
ELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDVNL
KHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHIISWEDLSKLGSSLARGIA
HLHSDHTPCGRPKVPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPALSVDDLANSGQV
GTARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVR
EHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFS
ELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccaccgcaagttccgaagtcggttaacaacgacatgatggtcaccgac
aacaatggtgcagtcaagcttccacaactgtgtaaattttgtgatgtgagattctccacc
tgtgacaaccagaagtcgtgcatgagcaattgcagtatcacctccatctgcgagaagcca
caggaagtctgtgtggctgtatggagaaagaatgatgagaacataacactagagactgtt
tgccatgaccccaggctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggcgagactttcttcatgtgttcctgtagctct
gaagagtgcaatgacaacatcatcttctcagaagactataacaccagcaatcctgacttg
ctgctagtcatatttcaagtgacaggcgtcagcctcctgccaccactggcaatcgccgta
tctgtcatcatcatcttctactgctaccgcgtgaaccggcagcagaagctgagttcatcc
tgggaaaccaccaagccccggaagctcatggagttcagcagcgagcactgtgccatcatc
ctggaagatgaccgctccgacatcagctccacgtgcgccaacaacatcaaccacaacacg
gagctgctgcccattgagctggacacgctggtggggaaaggtcgctttgctgaggtctat
aaggccaagctgaagcagaatacttcagagcagtttgagacagtggcagtcaagatcttt
ccctatgaggagtatgcctcctggaagacggagaaggacatcttctcagacgtcaacctg
aagcatgagaacatcctgcagttcctgacggccgaggagcggaagacggagttggggaaa
cagtactggctgatcaccgccttccacgccaagggcaacctacaggaatacctgacgcgg
catatcatcagctgggaggacctgagcaagctgggcagctccctcgcccggggcattgct
cacctccacagtgatcacaccccgtgcgggaggcccaaggtgcccatcgtgcacagggac
ctcaagagctccaatatcctcgtgaagaacgacctgacctgctgcctttgtgactttggg
ctttccctgcgactggaccctgctctgtctgtggatgacctggctaacagcgggcaggtg
ggaactgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaacgtt
gagtccttcaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatct
cgctgcaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgg
gagcacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgagggcgaccagaa
attcccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgag
tgctgggaccacgacccggaggcccgcctcacagcccagtgtgtggcggaacgcttcagt
gagctggagcacctggacaggctctcggggaggagctgctcggaggagaagattcctgaa
gacggctccctaaacactaccaaatag

DBGET integrated database retrieval system