KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034152
Entry
101034152         CDS       T04350                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit gamma-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04020  Calcium signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04114  Oocyte meiosis
sbq04140  Autophagy - animal
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq04371  Apelin signaling pathway
sbq04530  Tight junction
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04713  Circadian entrainment
sbq04714  Thermogenesis
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04740  Olfactory transduction
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04910  Insulin signaling pathway
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04962  Vasopressin-regulated water reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04976  Bile secretion
sbq05012  Parkinson disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101034152
   04014 Ras signaling pathway
    101034152
   04310 Wnt signaling pathway
    101034152
   04340 Hedgehog signaling pathway
    101034152
   04371 Apelin signaling pathway
    101034152
   04020 Calcium signaling pathway
    101034152
   04024 cAMP signaling pathway
    101034152
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101034152
  09143 Cell growth and death
   04114 Oocyte meiosis
    101034152
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101034152
   04540 Gap junction
    101034152
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101034152
   04062 Chemokine signaling pathway
    101034152
  09152 Endocrine system
   04911 Insulin secretion
    101034152
   04910 Insulin signaling pathway
    101034152
   04922 Glucagon signaling pathway
    101034152
   04923 Regulation of lipolysis in adipocytes
    101034152
   04912 GnRH signaling pathway
    101034152
   04913 Ovarian steroidogenesis
    101034152
   04915 Estrogen signaling pathway
    101034152
   04914 Progesterone-mediated oocyte maturation
    101034152
   04921 Oxytocin signaling pathway
    101034152
   04926 Relaxin signaling pathway
    101034152
   04935 Growth hormone synthesis, secretion and action
    101034152
   04918 Thyroid hormone synthesis
    101034152
   04919 Thyroid hormone signaling pathway
    101034152
   04928 Parathyroid hormone synthesis, secretion and action
    101034152
   04916 Melanogenesis
    101034152
   04924 Renin secretion
    101034152
   04925 Aldosterone synthesis and secretion
    101034152
   04927 Cortisol synthesis and secretion
    101034152
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101034152
   04270 Vascular smooth muscle contraction
    101034152
  09154 Digestive system
   04970 Salivary secretion
    101034152
   04971 Gastric acid secretion
    101034152
   04976 Bile secretion
    101034152
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101034152
   04961 Endocrine and other factor-regulated calcium reabsorption
    101034152
  09156 Nervous system
   04724 Glutamatergic synapse
    101034152
   04727 GABAergic synapse
    101034152
   04725 Cholinergic synapse
    101034152
   04728 Dopaminergic synapse
    101034152
   04726 Serotonergic synapse
    101034152
   04720 Long-term potentiation
    101034152
   04723 Retrograde endocannabinoid signaling
    101034152
  09157 Sensory system
   04740 Olfactory transduction
    101034152
   04742 Taste transduction
    101034152
   04750 Inflammatory mediator regulation of TRP channels
    101034152
  09149 Aging
   04211 Longevity regulating pathway
    101034152
   04213 Longevity regulating pathway - multiple species
    101034152
  09159 Environmental adaptation
   04713 Circadian entrainment
    101034152
   04714 Thermogenesis
    101034152
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034152
   05205 Proteoglycans in cancer
    101034152
   05203 Viral carcinogenesis
    101034152
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101034152
   05020 Prion disease
    101034152
  09165 Substance dependence
   05030 Cocaine addiction
    101034152
   05031 Amphetamine addiction
    101034152
   05032 Morphine addiction
    101034152
   05034 Alcoholism
    101034152
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101034152
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101034152
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034152
   05163 Human cytomegalovirus infection
    101034152
   05165 Human papillomavirus infection
    101034152
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101034152
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101034152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101034152
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101034152
   03036 Chromosome and associated proteins [BR:sbq03036]
    101034152
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101034152
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  PKA family
   101034152
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101034152
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101034152
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 101034152
NCBI-ProteinID: XP_010340193
LinkDB
Position
Unknown
AA seq 323 aa
MSEDMARYTIEGHGKNTCIRDNTTDSVKVQRVNGCCISRRIFVTHGPGDSQVDRGAPRVA
SVTLLADAAVLPASQCSQCPRAAVLNAEYTGLEERISPGGEMFSHLWRVRRFREPHACFC
AAQTILAFQYLHSLDLIHPNLKPENLLIDQQGYLQVTDFSLAKHMRHCTWTLCGTPEYLA
PEIILSKGYSKAMDWWALGVLTYEMVVGFPPFYADQRIQIYQILSGKVRFPSHVSSDPKD
LLRSLLHVDLTKHFGNLQNRVGDIKNHKWLVTTNWISIYEKKMEALFIAKFTGPGDASNF
DSYEEEEIRISINEKCANEFSEF
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtcagaggacatggcaaggtacactatagaaggacatggcaagaatacctgcattagg
gacaacactactgactcagtaaaagtgcagagagtgaatggatgctgcatttccagacgg
atttttgttactcacggaccaggagactcccaggtggacagaggagccccacgggtcgcc
agcgtgactcttttggccgacgccgctgttttgccagcatcccagtgcagccagtgtccc
agggcagcagttctcaatgcagaatatacgggactggaagaaaggatatccccgggtggg
gagatgttctcccacctatggcgcgtcagaaggttcagagagccccatgcctgtttctgt
gcggcccagaccattctggccttccagtacctgcactcgctcgacctcatccaccccaac
ctgaagccagagaacctcctcatcgaccagcagggatacctgcaggtgacagacttcagt
ctcgccaagcacatgaggcactgcacttggaccctgtgcgggacccctgagtacctggcc
cccgagatcatcctgagcaaaggctacagcaaggccatggactggtgggccctgggggtg
ctcacctacgagatggtcgtgggcttcccgcccttctacgccgaccagcggatccagatc
taccagatcctctctgggaaggtgcggttcccctcccacgtcagctccgaccccaaggac
ctgctgcggagcctgctgcacgtggacctcaccaagcacttcgggaacctccagaacagg
gtcggcgacatcaagaaccacaagtggttggtcacaaccaactggatttccatctatgag
aagaagatggaagctctcttcatcgcaaagttcacgggccccggggatgccagtaacttt
gacagctacgaggaggaagagatccggatctccatcaacgagaagtgtgccaatgagttt
tccgagttttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036705
Entry
101036705         CDS       T04350                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04020  Calcium signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04114  Oocyte meiosis
sbq04140  Autophagy - animal
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq04371  Apelin signaling pathway
sbq04530  Tight junction
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04713  Circadian entrainment
sbq04714  Thermogenesis
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04740  Olfactory transduction
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04910  Insulin signaling pathway
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04962  Vasopressin-regulated water reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04976  Bile secretion
sbq05012  Parkinson disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101036705 (PRKACA)
   04014 Ras signaling pathway
    101036705 (PRKACA)
   04310 Wnt signaling pathway
    101036705 (PRKACA)
   04340 Hedgehog signaling pathway
    101036705 (PRKACA)
   04371 Apelin signaling pathway
    101036705 (PRKACA)
   04020 Calcium signaling pathway
    101036705 (PRKACA)
   04024 cAMP signaling pathway
    101036705 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101036705 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101036705 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101036705 (PRKACA)
   04540 Gap junction
    101036705 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101036705 (PRKACA)
   04062 Chemokine signaling pathway
    101036705 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    101036705 (PRKACA)
   04910 Insulin signaling pathway
    101036705 (PRKACA)
   04922 Glucagon signaling pathway
    101036705 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    101036705 (PRKACA)
   04912 GnRH signaling pathway
    101036705 (PRKACA)
   04913 Ovarian steroidogenesis
    101036705 (PRKACA)
   04915 Estrogen signaling pathway
    101036705 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    101036705 (PRKACA)
   04921 Oxytocin signaling pathway
    101036705 (PRKACA)
   04926 Relaxin signaling pathway
    101036705 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    101036705 (PRKACA)
   04918 Thyroid hormone synthesis
    101036705 (PRKACA)
   04919 Thyroid hormone signaling pathway
    101036705 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    101036705 (PRKACA)
   04916 Melanogenesis
    101036705 (PRKACA)
   04924 Renin secretion
    101036705 (PRKACA)
   04925 Aldosterone synthesis and secretion
    101036705 (PRKACA)
   04927 Cortisol synthesis and secretion
    101036705 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101036705 (PRKACA)
   04270 Vascular smooth muscle contraction
    101036705 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    101036705 (PRKACA)
   04971 Gastric acid secretion
    101036705 (PRKACA)
   04976 Bile secretion
    101036705 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101036705 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101036705 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101036705 (PRKACA)
   04727 GABAergic synapse
    101036705 (PRKACA)
   04725 Cholinergic synapse
    101036705 (PRKACA)
   04728 Dopaminergic synapse
    101036705 (PRKACA)
   04726 Serotonergic synapse
    101036705 (PRKACA)
   04720 Long-term potentiation
    101036705 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    101036705 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    101036705 (PRKACA)
   04742 Taste transduction
    101036705 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    101036705 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    101036705 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    101036705 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101036705 (PRKACA)
   04714 Thermogenesis
    101036705 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036705 (PRKACA)
   05205 Proteoglycans in cancer
    101036705 (PRKACA)
   05203 Viral carcinogenesis
    101036705 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101036705 (PRKACA)
   05020 Prion disease
    101036705 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    101036705 (PRKACA)
   05031 Amphetamine addiction
    101036705 (PRKACA)
   05032 Morphine addiction
    101036705 (PRKACA)
   05034 Alcoholism
    101036705 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101036705 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101036705 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101036705 (PRKACA)
   05163 Human cytomegalovirus infection
    101036705 (PRKACA)
   05165 Human papillomavirus infection
    101036705 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101036705 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101036705 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101036705 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101036705 (PRKACA)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101036705 (PRKACA)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101036705 (PRKACA)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  PKA family
   101036705 (PRKACA)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101036705 (PRKACA)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101036705 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 101036705
NCBI-ProteinID: XP_003941750
UniProt: A0A2K6TUM1
LinkDB
Position
Unknown
AA seq 343 aa
MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDHFERIKTLGTGSFGRVMLVKHKETGN
HYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEFSFKDNSNLYMVMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFNEF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcttccaactccagcgatgtgaaagaattcttagccaaagccaaagaagattttctt
aaaaaatgggaaagtcccgctcagaacacagcccacttggatcactttgaacgaatcaag
accctcggcacgggctccttcgggcgggtgatgctggtgaaacacaaggagaccgggaac
cactatgccatgaagatcctcgacaaacagaaggtggtaaagctgaaacagatcgaacac
accctgaatgaaaagcgcatcctgcaagccgtcaactttccgttcctcgtcagactcgag
ttctccttcaaggacaactcaaacttatacatggtcatggagtacgtgcctggcggagag
atgttctcacacctacggcggattggaaggttcagtgagccccatgcccgtttctacgcg
gcccagatcgtcctgaccttcgaatatctgcactcgctggatctcatctacagggacctg
aagccggagaatctgctcatcgaccagcagggctacattcaggtgacagacttcggtttc
gccaagcgcgtgaagggccgcacttggaccttatgcgggacccctgagtacctggccccc
gagatcatcctgagcaaaggctacaacaaggcagtggactggtgggccctgggggttctt
atctatgagatggccgctggctacccgcccttcttcgcagaccagcccatccagatctat
gagaagatcgtctctgggaaggtgcggttcccttcccacttcagctctgacttgaaggac
ctcctgcggaacctcctgcaggtagatctcaccaagcgctttgggaacctcaagaatggg
gtcaacgatatcaagaaccacaagtggtttgccacgactgactggatcgccatctaccag
aggaaggtggaagctcccttcataccaaagtttaaaggccctggggatacgagtaacttt
gacgactatgaggaagaagaaattcgggtctccatcaatgagaagtgtggcaaggagttt
aatgaattttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101043989
Entry
101043989         CDS       T04350                                 

Gene name
PRKACG
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit gamma isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04020  Calcium signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04114  Oocyte meiosis
sbq04140  Autophagy - animal
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq04371  Apelin signaling pathway
sbq04530  Tight junction
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04713  Circadian entrainment
sbq04714  Thermogenesis
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04740  Olfactory transduction
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04910  Insulin signaling pathway
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04962  Vasopressin-regulated water reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04976  Bile secretion
sbq05012  Parkinson disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101043989 (PRKACG)
   04014 Ras signaling pathway
    101043989 (PRKACG)
   04310 Wnt signaling pathway
    101043989 (PRKACG)
   04340 Hedgehog signaling pathway
    101043989 (PRKACG)
   04371 Apelin signaling pathway
    101043989 (PRKACG)
   04020 Calcium signaling pathway
    101043989 (PRKACG)
   04024 cAMP signaling pathway
    101043989 (PRKACG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101043989 (PRKACG)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101043989 (PRKACG)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101043989 (PRKACG)
   04540 Gap junction
    101043989 (PRKACG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101043989 (PRKACG)
   04062 Chemokine signaling pathway
    101043989 (PRKACG)
  09152 Endocrine system
   04911 Insulin secretion
    101043989 (PRKACG)
   04910 Insulin signaling pathway
    101043989 (PRKACG)
   04922 Glucagon signaling pathway
    101043989 (PRKACG)
   04923 Regulation of lipolysis in adipocytes
    101043989 (PRKACG)
   04912 GnRH signaling pathway
    101043989 (PRKACG)
   04913 Ovarian steroidogenesis
    101043989 (PRKACG)
   04915 Estrogen signaling pathway
    101043989 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    101043989 (PRKACG)
   04921 Oxytocin signaling pathway
    101043989 (PRKACG)
   04926 Relaxin signaling pathway
    101043989 (PRKACG)
   04935 Growth hormone synthesis, secretion and action
    101043989 (PRKACG)
   04918 Thyroid hormone synthesis
    101043989 (PRKACG)
   04919 Thyroid hormone signaling pathway
    101043989 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    101043989 (PRKACG)
   04916 Melanogenesis
    101043989 (PRKACG)
   04924 Renin secretion
    101043989 (PRKACG)
   04925 Aldosterone synthesis and secretion
    101043989 (PRKACG)
   04927 Cortisol synthesis and secretion
    101043989 (PRKACG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101043989 (PRKACG)
   04270 Vascular smooth muscle contraction
    101043989 (PRKACG)
  09154 Digestive system
   04970 Salivary secretion
    101043989 (PRKACG)
   04971 Gastric acid secretion
    101043989 (PRKACG)
   04976 Bile secretion
    101043989 (PRKACG)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101043989 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101043989 (PRKACG)
  09156 Nervous system
   04724 Glutamatergic synapse
    101043989 (PRKACG)
   04727 GABAergic synapse
    101043989 (PRKACG)
   04725 Cholinergic synapse
    101043989 (PRKACG)
   04728 Dopaminergic synapse
    101043989 (PRKACG)
   04726 Serotonergic synapse
    101043989 (PRKACG)
   04720 Long-term potentiation
    101043989 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    101043989 (PRKACG)
  09157 Sensory system
   04740 Olfactory transduction
    101043989 (PRKACG)
   04742 Taste transduction
    101043989 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    101043989 (PRKACG)
  09149 Aging
   04211 Longevity regulating pathway
    101043989 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    101043989 (PRKACG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101043989 (PRKACG)
   04714 Thermogenesis
    101043989 (PRKACG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101043989 (PRKACG)
   05205 Proteoglycans in cancer
    101043989 (PRKACG)
   05203 Viral carcinogenesis
    101043989 (PRKACG)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101043989 (PRKACG)
   05020 Prion disease
    101043989 (PRKACG)
  09165 Substance dependence
   05030 Cocaine addiction
    101043989 (PRKACG)
   05031 Amphetamine addiction
    101043989 (PRKACG)
   05032 Morphine addiction
    101043989 (PRKACG)
   05034 Alcoholism
    101043989 (PRKACG)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101043989 (PRKACG)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101043989 (PRKACG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101043989 (PRKACG)
   05163 Human cytomegalovirus infection
    101043989 (PRKACG)
   05165 Human papillomavirus infection
    101043989 (PRKACG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101043989 (PRKACG)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101043989 (PRKACG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101043989 (PRKACG)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101043989 (PRKACG)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101043989 (PRKACG)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101043989 (PRKACG)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  PKA family
   101043989 (PRKACG)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101043989 (PRKACG)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101043989 (PRKACG)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH RIO1 Kdo FTA2
Other DBs
NCBI-GeneID: 101043989
NCBI-ProteinID: XP_003935685
LinkDB
Position
Unknown
AA seq 350 aa
MGNAPTKKDTEQEYVKEFLARAKEDFLYRWEHPSQNTASLDQFELLKTLGTGSFGRVVLV
RHRESGSHYAMKILNKQKVVKLKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSNLYLVM
EYVSGGEMFSHLRRVGKFTEPHACFYAAQVVLAFQYLHSLDLVHRDLKPENLLIDQQGYL
QVTDFGFAKRVRGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLTYEMAVGFPPFYG
QEPIQIYEKIVSGRVRFPSHVSSDLKDLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATT
NWIAIYEKKVEAPFIPKFAGPGDASNFDNYEEEEIRISINEKCAKEFSEF
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgggcaacgcccccaccaagaaggacaccgagcaggagtatgtgaaagagttcctagcc
agagccaaagaagatttcctctacagatgggaacacccctctcagaacaccgccagtttg
gatcagtttgaactgctgaagacgctgggcaccggctccttcgggcgggtggtgctggtg
aggcaccgggagagcggcagccactatgccatgaagatcctcaacaagcagaaggtggtg
aagctgaagcaggtcgagcacatcctgaacgagaagcgcatcctgcaggcgatcgacttt
ccgttcctcgtcaagctccagttctccttcaaggacaactccaacctgtacctggtgatg
gagtacgtgtcgggtggggagatgttctcccacctacggcgcgtcgggaagttcacagag
ccccatgcctgtttctatgctgcccaggtcgtcctggccttccagtacctgcactcgctc
gacctcgtccaccgcgacctgaagcccgagaacctcctcatcgaccagcaaggctacctg
caggttacggacttcggtttcgccaagcgcgtcaggggccgcacttggaccctgtgcggg
acccccgagtacctggcccctgagatcatcctgagcaaaggttacaacaaggccgtggac
tggtgggccctgggggtgctcacctacgagatggccgtgggcttcccgcccttctacggc
caggaacccatccagatctatgagaagatcgtctctgggagggtgcggttcccctcccac
gtcagctctgacctcaaggacctgctgcggagtctgctgcaggtggacctcacgaaacgc
ttcgggaacctccggaacggggtcggcgacatcaagaaccacaagtggttcgccacaacc
aactggattgccatctatgagaagaaggtggaagctcccttcatcccgaagttcgcaggc
cctggggatgccagtaactttgacaactacgaggaggaagagatacggatctccatcaac
gagaagtgtgctaaagagttttctgagttttag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047300
Entry
101047300         CDS       T04350                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04020  Calcium signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04114  Oocyte meiosis
sbq04140  Autophagy - animal
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04270  Vascular smooth muscle contraction
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq04371  Apelin signaling pathway
sbq04530  Tight junction
sbq04540  Gap junction
sbq04611  Platelet activation
sbq04713  Circadian entrainment
sbq04714  Thermogenesis
sbq04720  Long-term potentiation
sbq04723  Retrograde endocannabinoid signaling
sbq04724  Glutamatergic synapse
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04727  GABAergic synapse
sbq04728  Dopaminergic synapse
sbq04740  Olfactory transduction
sbq04742  Taste transduction
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04910  Insulin signaling pathway
sbq04911  Insulin secretion
sbq04912  GnRH signaling pathway
sbq04913  Ovarian steroidogenesis
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04918  Thyroid hormone synthesis
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04924  Renin secretion
sbq04925  Aldosterone synthesis and secretion
sbq04926  Relaxin signaling pathway
sbq04927  Cortisol synthesis and secretion
sbq04928  Parathyroid hormone synthesis, secretion and action
sbq04934  Cushing syndrome
sbq04935  Growth hormone synthesis, secretion and action
sbq04961  Endocrine and other factor-regulated calcium reabsorption
sbq04962  Vasopressin-regulated water reabsorption
sbq04970  Salivary secretion
sbq04971  Gastric acid secretion
sbq04976  Bile secretion
sbq05012  Parkinson disease
sbq05020  Prion disease
sbq05030  Cocaine addiction
sbq05031  Amphetamine addiction
sbq05032  Morphine addiction
sbq05034  Alcoholism
sbq05146  Amoebiasis
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047300 (PRKACB)
   04014 Ras signaling pathway
    101047300 (PRKACB)
   04310 Wnt signaling pathway
    101047300 (PRKACB)
   04340 Hedgehog signaling pathway
    101047300 (PRKACB)
   04371 Apelin signaling pathway
    101047300 (PRKACB)
   04020 Calcium signaling pathway
    101047300 (PRKACB)
   04024 cAMP signaling pathway
    101047300 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101047300 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101047300 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101047300 (PRKACB)
   04540 Gap junction
    101047300 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101047300 (PRKACB)
   04062 Chemokine signaling pathway
    101047300 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    101047300 (PRKACB)
   04910 Insulin signaling pathway
    101047300 (PRKACB)
   04922 Glucagon signaling pathway
    101047300 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    101047300 (PRKACB)
   04912 GnRH signaling pathway
    101047300 (PRKACB)
   04913 Ovarian steroidogenesis
    101047300 (PRKACB)
   04915 Estrogen signaling pathway
    101047300 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    101047300 (PRKACB)
   04921 Oxytocin signaling pathway
    101047300 (PRKACB)
   04926 Relaxin signaling pathway
    101047300 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    101047300 (PRKACB)
   04918 Thyroid hormone synthesis
    101047300 (PRKACB)
   04919 Thyroid hormone signaling pathway
    101047300 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    101047300 (PRKACB)
   04916 Melanogenesis
    101047300 (PRKACB)
   04924 Renin secretion
    101047300 (PRKACB)
   04925 Aldosterone synthesis and secretion
    101047300 (PRKACB)
   04927 Cortisol synthesis and secretion
    101047300 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101047300 (PRKACB)
   04270 Vascular smooth muscle contraction
    101047300 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    101047300 (PRKACB)
   04971 Gastric acid secretion
    101047300 (PRKACB)
   04976 Bile secretion
    101047300 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101047300 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101047300 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101047300 (PRKACB)
   04727 GABAergic synapse
    101047300 (PRKACB)
   04725 Cholinergic synapse
    101047300 (PRKACB)
   04728 Dopaminergic synapse
    101047300 (PRKACB)
   04726 Serotonergic synapse
    101047300 (PRKACB)
   04720 Long-term potentiation
    101047300 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    101047300 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    101047300 (PRKACB)
   04742 Taste transduction
    101047300 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    101047300 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    101047300 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    101047300 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101047300 (PRKACB)
   04714 Thermogenesis
    101047300 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047300 (PRKACB)
   05205 Proteoglycans in cancer
    101047300 (PRKACB)
   05203 Viral carcinogenesis
    101047300 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101047300 (PRKACB)
   05020 Prion disease
    101047300 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    101047300 (PRKACB)
   05031 Amphetamine addiction
    101047300 (PRKACB)
   05032 Morphine addiction
    101047300 (PRKACB)
   05034 Alcoholism
    101047300 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101047300 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101047300 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047300 (PRKACB)
   05163 Human cytomegalovirus infection
    101047300 (PRKACB)
   05165 Human papillomavirus infection
    101047300 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101047300 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101047300 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101047300 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101047300 (PRKACB)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101047300 (PRKACB)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101047300 (PRKACB)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  PKA family
   101047300 (PRKACB)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101047300 (PRKACB)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101047300 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 101047300
NCBI-ProteinID: XP_003921417
UniProt: A0A2K6UMJ3
LinkDB
Position
Unknown
AA seq 398 aa
MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWD
RSMKEFLAKAKEDFLKKWENPTPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEA
PFIPKFRGSGDTSNFDDYEEEDIRVSITEKCGREFDEF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaaccaccttgtaaccagtatacaggtacaactacagctcttcag
aaattggaaggttttgctagccggttatttcatagacactccaaaggtactgcacatgat
cagaaaacagctctggaaaatgacagccttcatttctctgaacatactgccttatgggac
agatcaatgaaagagtttctagccaaagccaaagaagactttttgaaaaaatgggagaat
ccaactccgaataatgctggacttgaagattttgaaaggaaaaaaacccttggaacaggt
tcatttggaagagtcatgttagtaaaacacaaagccactgaacagtattatgccatgaag
atcttagataagcagaaggtcgttaaactgaagcaaatagagcatactttgaatgagaaa
agaatattacaggcagtgaattttcctttccttgttcgactggagtatgcttttaaggat
aattctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcacatcta
agaagaattggaaggttcagtgaaccccacgcacggttctatgcagctcagatagtacta
acattcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctc
ttaattgaccatcaaggctatatccaggtcacagactttgggtttgccaaaagagttaaa
ggcagaacttggacattatgtggaactccagagtatttggctccagaaataattctcagc
aagggctacaataaggcagtggattggtgggcattaggagtgctaatctatgaaatggca
gctggctatcccccattctttgcagaccaaccaattcagatttatgaaaagattgtttct
ggaaaggtccgattcccatcgcacttcagctcagatctcaaggaccttctacggaacctg
ctgcaggtggatttgaccaagagatttggaaatctaaagaacggtgtcagtgatataaaa
actcacaagtggtttgccacgacagattggattgctatttaccagaggaaggttgaagct
ccattcataccaaagtttagaggctctggagataccagcaactttgatgactatgaagaa
gaagatatccgtgtctctataacagaaaaatgtggaagagaatttgatgaattttaa

DBGET integrated database retrieval system