KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034220
Entry
101034220         CDS       T04350                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial isoform X1
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00220  Arginine biosynthesis
sbq00330  Arginine and proline metabolism
sbq01100  Metabolic pathways
sbq04020  Calcium signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04611  Platelet activation
sbq04915  Estrogen signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04931  Insulin resistance
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101034220 (NOS3)
   00330 Arginine and proline metabolism
    101034220 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101034220 (NOS3)
   04371 Apelin signaling pathway
    101034220 (NOS3)
   04066 HIF-1 signaling pathway
    101034220 (NOS3)
   04020 Calcium signaling pathway
    101034220 (NOS3)
   04071 Sphingolipid signaling pathway
    101034220 (NOS3)
   04022 cGMP-PKG signaling pathway
    101034220 (NOS3)
   04151 PI3K-Akt signaling pathway
    101034220 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101034220 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101034220 (NOS3)
   04921 Oxytocin signaling pathway
    101034220 (NOS3)
   04926 Relaxin signaling pathway
    101034220 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101034220 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101034220 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101034220 (NOS3)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101034220 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 101034220
NCBI-ProteinID: XP_010338771
LinkDB
Position
Unknown
AA seq 1204 aa
MGNLKSVAQESGPPCGLGLGLGLGLCGKQSPATPAPEPSRAPASPPPPAPEHSSPPSSPL
TQPPEGPRFPRVKNWEVGSIAYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPTA
PEQLLSQARAFINQYYSSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWR
NAPRCVGRIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRG
DFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGSGRFDVLPLLLQAPDEP
PEIFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMS
TEIGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVD
HHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDP
WKGSAAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQGYAQQLG
RLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNS
SPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPH
FCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAA
ARDIFSPKRSWKRQRYRLSAQAEGLQLLPGLIHVHRRKMFQATILSVENLQSSKSTRATI
LVRLDTAGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGSPGG
PPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPREQQELEALSQDPRR
YEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSIHPGEIHLTVAV
LAYRTQDGLGPLHYGVCSTWLSQLKPGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIA
PFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSR
EPDNPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILTTEGDMEL
DEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWAFDLPASD
TNGP
NT seq 3615 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtggcccaggagtctgggccgccctgtggcttggggctgggg
ctaggcctcgggctgtgcggcaagcagagcccagctaccccggcccctgagcccagccga
gccccagcatcccctcccccaccagcgccagaacacagcagccccccgagctccccgcta
acccagccaccggaggggcccagattccctcgagtgaagaactgggaagtgggcagcatc
gcctatgacaccctcagcgcccaggcacagcaggatgggccctgcaccccaagacgctgc
ctgggctccctggtatttccgaggaaactgcagggccggccctccccgggccccacagcc
cctgagcagctgctgagtcaggcccgggccttcatcaaccagtactacagctccatcaag
aggagcggctcccaggcccacgagcagcggcttcaagaggtggaagccgaggtggcagcc
acaggcacctaccagcttagggagagcgagctggtgttcggggccaagcaggcctggcgc
aacgctccccgctgtgtgggccggatccagtgggggaagctgcaggtgttcgatgcccgg
gactgcaggtctgcacaggagatgttcacctacatctgcaaccacatcaagtatgccacc
aaccggggcaaccttcgctcggccatcacagtgttcccgcagcgctgccctggccgcgga
gacttccgaatctggaacagccagctggtgcgctacgcgggctaccggcagcaggacggc
tccgtgcggggggacccggccaacgtggagatcactgagctctgcatccagcacggctgg
accccaggaagcggccgcttcgatgtgctgcccctgctgctgcaggccccagacgagccc
ccagaaatcttccttctgcccccagagctggtccttgaggtgcccctggagcaccccacg
ctggagtggttcgcagccctgggcctgcgctggtatgccctcccagcggtgtccaacatg
ctgctggaaattgggggtctggagttccctgcagcccccttcagtggctggtacatgagc
actgagattggcaccaggaacctgtgtgacccccaccgctacaacatcctggaggacgtg
gctgtctgcatggacctggatacccggacgacctcgtccctgtggaaagacaaggcagcg
gtggaaatcaacttggctgtgctgcacagttaccagctggccaaagtgaccatcgtggac
caccacgctgccacagcctccttcatgaagcacctggagaatgagcagaaggccaggggg
ggctgccctgcagactgggcctggatcgtgccccccatctcaggcagcctcactcctgtc
ttccatcaggagatggtcaactatttcctgtcccctgccttccgctaccagccagacccc
tggaaggggagtgcagccaagggaaccggcatcaccaggaagaagacctttaaggaagtg
gccaacgccgtgaagatctccgcctcgctcatgggcactgtgatggcgaagcgagtgaag
gcaacaatcctgtatggctctgagaccggccgggcccagggctatgcacagcagttgggg
agactcttccggaaggcttttgacccccgggtcctgtgtatggatgagtatgacgtggtg
tccctcgaacacgagacgctggtgctggtggtaaccagcacatttgggaatggggatccc
ccggagaatggagagagctttgcggctgcgctgatggagatgtccggcccctacaacagc
tccccgcggccggagcagcacaagagttataagatccgcttcaacagcgtctcctgctca
gacccactggtgtcctcgtggcggcgaaagaggaaggagtccagtaacacagacagtgca
ggggccctgggcaccctcaggttctgtgtgttcgggctgggctcccgcgcatacccccac
ttctgcgcctttgctcgagcggtggacacgcggctggaggaactgggcggggagcggctg
ctgcagctgggccagggcgacgagctctgtggccaggaggaagccttccgtggctgggcc
caggccgccttccaggccgcctgtgagaccttctgtgtgggagaggatgccaaagctgcc
gcccgagacatcttcagccccaaacggagctggaaacgccagaggtaccggctgagcgcc
caggccgagggcctgcagttgctgccaggtctgatccacgtgcacaggcggaagatgttc
caggctacaatcctttcagtggaaaacctgcaaagcagcaagtccacgcgggccaccatc
ctggtgcgcctggacaccgcagggcaggaggggctgcagtaccagccgggggaccacata
ggcgtctgcccacccaaccggcccggccttgtggaggcgctgctgagccgagtggaggat
ccaccagcacccactgagcccgtggcagtagagcagctggagaagggcagccctggtggc
cctccccctggctgggtgcgggaccctcgactgcccccgtgcacactgcgccaggctctc
accttcttcctggacatcacctccccacccagtcctcagctcttgcggctgctcagcacc
ctggcagaagagcccagggaacagcaggagctggaggccctcagccaggatccccggcgc
tacgaggagtggaagtggttccgctgccccacactgctggaggtgctggagcagttccct
tcggtggcactgcctgccccactgctcctcacccagctgcctctgctgcagccccggtac
tactcagtcagctcagcacccagcatccacccaggagagatccacctcactgtagctgtg
cttgcatacaggacccaggatgggctgggccccctgcactatggagtctgctccacatgg
ctaagccaactcaagcctggagaccctgtgccctgcttcatccggggggctccctctttc
cggctgccacccgatcccagcctgccctgcatcctggtgggcccaggcactggcattgcc
ccctttcggggattctggcaggagcggctgcatgacattgagagcaaagggctgcagccc
gcccccatgactttggtgttcggctgccgatgctcccaacttgaccatctctaccgcgac
gaggtgcaggacgcccagcagcgcggggtgtttggccgagtcctcaccgccttctcccgg
gaacccgacaatcccaagacctacgtgcaggacatcctaaggacggagctggctgcggag
gtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcaccatg
gcaaccaacgtcctgcagaccgtgcagcgaatcctgacgacggagggcgacatggagctg
gatgaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaagacatt
tttgggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagtttttcc
ttgcaggagcggcaactgcggggcgcagtgccctgggcgttcgacctgcccgcctcagac
accaatggcccctga

DBGET integrated database retrieval system