KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034259
Entry
101034259         CDS       T04350                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03460  Fanconi anemia pathway
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05210  Colorectal cancer
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05216  Thyroid cancer
sbq05217  Basal cell carcinoma
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    101034259 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034259 (POLK)
   05202 Transcriptional misregulation in cancer
    101034259 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101034259 (POLK)
   05212 Pancreatic cancer
    101034259 (POLK)
   05225 Hepatocellular carcinoma
    101034259 (POLK)
   05226 Gastric cancer
    101034259 (POLK)
   05214 Glioma
    101034259 (POLK)
   05216 Thyroid cancer
    101034259 (POLK)
   05220 Chronic myeloid leukemia
    101034259 (POLK)
   05217 Basal cell carcinoma
    101034259 (POLK)
   05218 Melanoma
    101034259 (POLK)
   05213 Endometrial cancer
    101034259 (POLK)
   05224 Breast cancer
    101034259 (POLK)
   05222 Small cell lung cancer
    101034259 (POLK)
   05223 Non-small cell lung cancer
    101034259 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101034259 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sbq03400]
    101034259 (POLK)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     101034259 (POLK)
DNA repair and recombination proteins [BR:sbq03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    101034259 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 101034259
NCBI-ProteinID: XP_003920890
UniProt: A0A2K6UZD4
LinkDB
Position
Unknown
AA seq 863 aa
MDGTKEKNDGYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSKFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAVELEQSRNLNNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLTTSNYCARRFGVRAAMPGFIAKRLCPHLIIVPPNFDKYRAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLQERQNWPEDKRRYFIKMGNSVENDNPGKEVNK
LSEHERSISPLLFEESPPDLQPSGDEEQNNPQILQNSVVFGTSAEEVVKEIRFRIEQKTT
LTASAGIAPNTMLAKVCSDKNKPNGQYQILPDRQAVMDFIKDLPIRKVSGIGKVTEKMLK
ALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVERTFSEIN
KAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVISTAEEIFA
IAKELLKTEIDADFPHPLRLRLMGVRISSFPSEEDRKHQQRSIIAFLQAGNQTPSASGCI
LEKTNKDKFAKPLEVSHKKSFFDKKRSERKWSHQDTFKCDTMNEQSLQTSQLFPVLKKMN
ENLEISENSDNCQIFTCPICFRAQGYISLEAFNKHVDACLDGCSISENSKMFSCSHVSAT
KVNKKENISSSSLYDKQGDEAHPKNKEISSVDCVDLVDTIHNSSKAESIDALSNKHSKEE
CSSLPSKSFNIEHCHQNSCTVSLENEDVGLLSRPESCQPYLCKVVTGQALVCPVCNVEQK
TLDLTLFNVHVDVCLNRSVIQELRRDKVNPVNQPKESSKSTGSSSGVQKTVTRTKRPGLR
TKYSTSKKIKPNNPKHTLDTFFK
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggatggcacaaaggagaagaatgatggttacaaagatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacaaaggggtccaaattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcagtggaattagaacagagccgaaatttgaac
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaactgaaggataaacccattgctgtaggatcaatgagtatgctgactacttcaaat
tactgtgcaaggaggtttggtgttcgtgcagctatgccaggatttattgctaagagactc
tgcccacatcttataatagtgcccccaaactttgacaaataccgagctgtgagtaaagag
gttaaagaaatacttgctgattatgatcccaattttatggccatgagtcttgatgaagcc
tacttgaatataacaaagcacttacaagaaagacaaaattggcctgaggataaaagaagg
tatttcattaaaatgggaaactcagtagaaaatgataatccaggaaaggaagttaataaa
ctgagcgagcatgaacgatccatctctccgctactttttgaagagagtcctcctgatttg
cagccctcaggagatgaagagcaaaacaatcctcaaatactccaaaactcagttgttttt
ggaacatcagccgaggaagtggtaaaggaaattcgtttcagaatcgagcaaaaaacaaca
ctgacagccagtgcaggcattgccccaaatacaatgttagcaaaagtatgcagtgataag
aataaaccaaatggacaataccaaattctccccgatagacaagctgtgatggacttcatc
aaggatttacccattagaaaggtttctggaataggaaaagttacagaaaaaatgttaaag
gcccttggaattattacatgcacagaactttaccaacagagggcattgctttctctcctt
ttctctgaaacatcttggcattatttccttcatatctctttgggtctaggctcaacacac
ctgacaagggatggagagaggaagagtatgagcgttgagaggactttcagtgagataaat
aaagcagaagaacaatacagcctatgccaagaactttgcagtgaacttgctcaagatctg
cagaaagaaggacttaagggtagaactgttaccattaagttgaagaatgtgaattttgaa
gtaaaaactcgtgcatctacagtttcgtctgttatttctactgcagaagaaatatttgcc
attgctaaggagttactaaaaacagaaattgatgctgattttccacatcccttaagattg
agacttatgggtgttcggatatctagttttcccagtgaagaagacaggaaacaccaacaa
aggagcattattgcctttttacaggctggaaaccaaaccccatcagccagtgggtgtata
ctagagaaaactaacaaagataagtttgcaaaacctctagaagtgtctcataagaagagt
ttctttgataaaaaacgatcagaaaggaaatggagccaccaagatacatttaaatgtgac
accatgaatgaacaaagtttacagacatcacagctattcccagttttaaagaagatgaat
gagaatttggaaatatcagagaattcagataactgtcagatatttacctgccctatttgc
tttagggcgcaaggatacatcagtctggaagcctttaataaacatgtagatgcatgtctc
gatggatgttcaatcagtgaaaactctaaaatgttctcatgttcacatgtttctgcaacc
aaagttaacaagaaagaaaatatttcttcttcttcactttatgacaagcaaggtgatgaa
gcccatccaaaaaataaagaaatatcttcagtagattgtgtagatttagtagatactata
cataactcatctaaagcagaaagcatagatgctttaagtaataagcatagcaaggaagaa
tgttctagtctcccaagcaagtcttttaatattgaacactgtcatcagaattcttgtact
gtttcattggaaaatgaagatgttggattattaagtagaccagaatcctgccagccttat
ttatgtaaagtggtaacaggccaagctctagtttgtcctgtttgtaacgtagaacaaaag
actttagatctaaccctgttcaatgtgcacgtagatgtttgcttaaatagaagtgttatc
caagaactaagaagggataaagttaacccagttaatcaacccaaagaaagctccaaaagt
actggtagctcaagtggagtacagaagactgtaacaagaacaaaaaggccaggattgaga
acaaagtactcaacatcaaagaaaataaaaccaaacaatcccaaacatacccttgataca
ttttttaagtaa

DBGET integrated database retrieval system