KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034279
Entry
101034279         CDS       T04350                                 

Definition
(RefSeq) bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04390  Hippo signaling pathway
sbq05016  Huntington disease
sbq05162  Measles
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101034279
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101034279
   04215 Apoptosis - multiple species
    101034279
   04115 p53 signaling pathway
    101034279
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034279
  09162 Cancer: specific types
   05210 Colorectal cancer
    101034279
  09164 Neurodegenerative disease
   05016 Huntington disease
    101034279
  09172 Infectious disease: viral
   05162 Measles
    101034279
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101034279
SSDB
Other DBs
NCBI-GeneID: 101034279
NCBI-ProteinID: XP_010349307
UniProt: A0A2K6STB4
LinkDB
Position
Unknown
AA seq 101 aa
MKCGMGSAWACPCQVPRASSLTWVPCQMCETRRAAATPPLTLEGPVQSHHGTPALSQGPQ
SPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM
NT seq 306 nt   +upstreamnt  +downstreamnt
atgaaatgtggcatggggtctgcctgggcatgtccatgccaagtgcccagggcttcttcc
ttgacgtgggtcccctgccagatgtgtgagacaagaagagcagccgcaacaccgcccctc
accctggagggtcctgtacaatctcatcatgggactcctgccctttcccaggggccacag
agccccagagatggagcccaattaggtgcctgcacccgcccggtggacgtcagggactcg
gggggcaggcccctcccacctcctgacaccctggccagcgcgggggactttctctgcacc
atgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 104653273
Entry
104653273         CDS       T04350                                 

Definition
(RefSeq) bcl-2-binding component 3-like
  KO
K10132  Bcl-2-binding component 3
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04215  Apoptosis - multiple species
sbq04390  Hippo signaling pathway
sbq05016  Huntington disease
sbq05162  Measles
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    104653273
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104653273
   04215 Apoptosis - multiple species
    104653273
   04115 p53 signaling pathway
    104653273
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104653273
  09162 Cancer: specific types
   05210 Colorectal cancer
    104653273
  09164 Neurodegenerative disease
   05016 Huntington disease
    104653273
  09172 Infectious disease: viral
   05162 Measles
    104653273
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104653273
SSDB
Motif
Pfam: PUMA
Other DBs
NCBI-GeneID: 104653273
NCBI-ProteinID: XP_010349441
LinkDB
Position
Unknown
AA seq 109 aa
MARARQEGSSPEPVEGLARDGPPGKACPGFPSPILSLRPEGSSQPSLSLAEQHLESPVPS
APGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRGGAG
NT seq 330 nt   +upstreamnt  +downstreamnt
atggcccgcgcacgccaggagggcagctccccggagcccgtagagggcctggcccgcgac
ggcccgcccgggaaagcgtgtcctggtttcccatcccccatcctgtccctgcggcccgag
ggtagttctcagccctcgctctcgctggcggagcagcacctggagtcgcccgtgcccagc
gccccgggggccctggcgggcggtcccacccaggcggccccgggagtccgcggggaggag
gagcagtgggctcgggagatcggggcccagctgcggcggatggcggacgacctcaacgcg
cagtacgagcggcggggaggggcgggatag

DBGET integrated database retrieval system