KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034328
Entry
101034328         CDS       T04350                                 

Gene name
CCR4
Definition
(RefSeq) C-C chemokine receptor type 4
  KO
K04179  C-C chemokine receptor type 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04062  Chemokine signaling pathway
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034328 (CCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101034328 (CCR4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101034328 (CCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101034328 (CCR4)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034328 (CCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sbq04030]
    101034328 (CCR4)
   04050 Cytokine receptors [BR:sbq04050]
    101034328 (CCR4)
   04090 CD molecules [BR:sbq04090]
    101034328 (CCR4)
G protein-coupled receptors [BR:sbq04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101034328 (CCR4)
Cytokine receptors [BR:sbq04050]
 Chemokine receptors
  CC Chemokine
   101034328 (CCR4)
CD molecules [BR:sbq04090]
 Proteins
  101034328 (CCR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 101034328
NCBI-ProteinID: XP_003930968
UniProt: A0A2K6SGN8
LinkDB
Position
Unknown
AA seq 360 aa
MNPTDIADTTLDESMYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKIISWMYLVG
FYSGIFFIMLMSIDRYLAIVHAVFSLRARTLTSGVVTSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGVMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTLDHDLHDAL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaaccccacggatatagcagacaccaccctcgatgaaagcatgtacagcaattactat
ctgtatgaaagtatccccaagccttgcaccaaagaaggcatcaaggcatttggggagctc
ttcctgcctccgctgtactccttggtttttgtgtttggtctgctgggaaattctgtggtg
gttctggtcctgttcaaatacaagcggctcaggtccatgacggacgtgtacctgctcaac
cttgccatctcggacctgctcttcgtgttctccctccctttctggggctactacgcagca
gaccagtgggtttttgggttaggtctgtgcaagatcatttcctggatgtacttggtaggc
ttttacagtggcatattctttatcatgcttatgagtattgatagatacctggcaattgtg
catgcggtgttttccttgagggcgaggaccttgacttctggggtcgtcaccagtttggct
acctggtcagtggctgtgttcgcctcccttccgggctttctgttcagcacttgttacact
gaacgcaaccatacctactgcaaaaccaagtactctctcaactccacaacgtggaaggtt
ctcagctccctggaaatcaacattctggggttggtgatccccttgggggtcatgctgttt
tgctactccatgatcatcaggaccctgcagcactgtaaaaacgagaagaagaacaaggcg
gtgaagatgatctttgccgtggtggtcctcttccttgggttctggacaccttacaacatt
gtgctcttcctagagaccctggtagagctagaagtccttcaggactgcacctttgaaaga
tacctggactatgccatccaggccacagaaactctggcttttgttcactgctgccttaat
cccatcatctacttttttctgggggagaagtttcgcaagtatatcctccagctcttcaaa
acctgcagggggctttttgtgctctgccaatactgtgggctcctccaaatttactctgct
gacacccccagctcatcttacacgcagtccaccctggatcatgatctccatgatgctctg
tag

DBGET integrated database retrieval system