KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034383
Entry
101034383         CDS       T04350                                 

Gene name
SNW1
Definition
(RefSeq) LOW QUALITY PROTEIN: SNW domain-containing protein 1
  KO
K06063  SNW domain-containing protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03040  Spliceosome
sbq04330  Notch signaling pathway
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101034383 (SNW1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101034383 (SNW1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101034383 (SNW1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101034383 (SNW1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sbq03041]
    101034383 (SNW1)
Spliceosome [BR:sbq03041]
 Complex B
  Other components
   Prp19-related factors
    101034383 (SNW1)
 Complex C
    101034383 (SNW1)
SSDB
Motif
Pfam: SKIP_SNW
Other DBs
NCBI-GeneID: 101034383
NCBI-ProteinID: XP_003924655
LinkDB
Position
Unknown
AA seq 536 aa
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKXHGGSKRPSDSSRPKEHEHEGKKRRKE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcgctcaccagctttttacctgcacctactcagctatctcaggaccagctcgaggct
gaagaaaaggcaagatcccagagatcacggcagacctcattggtctcctcgcgaagagag
cctcccccgtacggatatcggaaaggctggatacctcggttattagaggattttggagat
ggaggtgcttttccagagatccatgtggctcagtatccactggatatgggacgaaagaaa
aaaatgtcgaatgcactggccattcaggtggattctgaaggaaaaattaaatatgatgca
atcgctcgacaaggacagtcgaaagacaaggtcatttacagcaaatacactgacctggtt
ccaaaggaggttatgaatgcagatgacccagacctgcaaaggcccgatgaagaagctatt
aaagagataacagaaaagacaagagtagccttagaaaaatctgtatcacagaaggttgct
gcagccatgccagttcgggcagctgacaaactggctcctgctcagtatatccgatacaca
ccatctcagcaaggagtggctttcaactctggagctaaacagagggttattcggatggta
gaaatgcagaaggatccaatggagcctccaaggttcaagattaataagaaaattccccgg
ggaccaccttctcctcctgcacctgtcatgcattctcctagccgaaagatgactgtaaag
gaacaacaagagtggaagattcctccttgtatttctaactggaaaaatgcaaagggttat
acaattccattagacaaacgtctggctgctgatggaagaggactacagacagtacacata
aatgaaaattttgccaaactggccgaagccctctacattgctgatcggaaggctcgtgaa
gctgtggaaatgcgtgcccaggtagagagaaaaatggctcaaaaagaaaaggaaaaacat
gaagagaaacttagagaaatggcccagaaagccagggagagaagagctgggatcaaaact
catgtggaaaaagaggatggggaggcacgtgagagggatgaaatccggcatgacagacga
aaagagagacagcatgatcggaatctttccagggcagctcctgataagaggtcgaaactt
cagagaaatgaaaatcgggatatcagtgaggtcattgctctcggtgttcccaatcctcgg
acttccaatgaagttcagtatgaccaaaggctcttcaaccaatccaagggtatggacagt
ggatttgcaggtggagaagatgaaatttataatgtttatgatcaagcctggagaggtggt
aaagatatggcccagagtatttataggcccagtaaaaatctggacaaggacatgtatggt
gatgacctagaagccagaataaagaccaacagatttgttcccgacaaggagttttctggt
tcagaccgtaggcagagaggccgagaaggaccagttcagtttgaggaagatccttttggt
ttggacaagtttttggaagaagccaaatagcatggtggctctaaaagaccctcagatagc
agccgccccaaggaacatgagcatgaaggcaagaagaggaggaaggagtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101051497
Entry
101051497         CDS       T04350                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: SNW domain-containing protein 1-like
  KO
K06063  SNW domain-containing protein 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq03040  Spliceosome
sbq04330  Notch signaling pathway
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101051497
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101051497
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101051497
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101051497
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sbq03041]
    101051497
Spliceosome [BR:sbq03041]
 Complex B
  Other components
   Prp19-related factors
    101051497
 Complex C
    101051497
SSDB
Motif
Pfam: SKIP_SNW SIR4_SID
Other DBs
NCBI-GeneID: 101051497
NCBI-ProteinID: XP_010337101
LinkDB
Position
Unknown
AA seq 536 aa
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWISRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGXGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPNKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKXHGGSKRPSDSSRPKEHEHEGKKRRKE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcgctcaccagctttttacctgcacctactcagctatctcaggaccagctcgaggct
gaagaaaaggcaagatcccagagatcacggcagacctcattggtctcctcgcgaagagag
cctcccccgtacggatatcggaaaggctggatatctcggttattagaggattttggagat
ggaggtgcttttccagagatccatgtggctcagtatccactggatatgggacgaaagaaa
aaaatgtcgaatgcactggccattcaggtggattctgaaggaaaaattaaatatgatgca
atagctcgacaaggacagtcgaaagacaaggtcatttacagcaaatacactgacctggtt
ccaaaggaggttatgaatgcagatgacccagacctgcaaaggcccgatgaagaagctatt
aaagagataacagaaaagacaagagtagccttagaaaaatctgtatcacagaaggttgct
gcagccatgccagttcgggcagctgacaaactggctcctgctcagtatatccgatacaca
ccatctcagcaaggagtggctttcaactctggagctaaacagagggttattcgaatggta
gaaatgcagaaggatccaatggagcctccaaggttcaagattaataagaaaattccccgg
ggaccaccttctcctcctgcacctgtcatgcattctcctagccgaaaaatgactgtaaag
gaacaacaagagtggaagattcctccttgtatttctaactggaaaaatgcaaagggttat
acaattccattagacaaacgtctggctgctgatggangaggactacagacagtacacata
aatgaaaattttgccaaactggccgaagccctctacattgctgatcggaaggctcgtgaa
gctgtggaaatgcgtgcccaggtagagagaaaaatggctcaaaaagaaaaggaaaaacat
gaagagaaacttagagaaatggcccagaaagccagggagagaagagctgggatcaaaact
catgtggaaaaagaggatggggaggcacgtgagagggatgaaatccggcatgacaggcga
aaagagagacagcatgatcggaatctttccagggcagctcctaataagaggtcgaaactt
cagaggaatgaaaatcgggatatcagtgaggtcattgctctcggtgttcccaatcctcgg
acttccaatgaagttcaatatgaccaaaggctcttcaaccaatccaagggtatggacagt
ggatttgcaggtggagaagatgaaatttataatgtttatgatcaagcctggagaggtggt
aaagatatggcccagagtatttataggcccagtaaaaatctggacaaggacatgtatggt
gatgacctagaagccagaataaagaccaacagatttgttcccgacaaggagttttctggt
tcagaccgtaggcagagaggccgagaaggaccagttcagtttgaggaagatccttttggt
ttggacaagtttttggaagaagccaaatagcatggtggctctaaaagaccctcagatagc
agccgccccaaggaacatgagcatgaaggcaagaagaggaggaaggagtag

DBGET integrated database retrieval system