KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034499
Entry
101034499         CDS       T04350                                 

Gene name
ACADL
Definition
(RefSeq) LOW QUALITY PROTEIN: long-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00255  long-chain-acyl-CoA dehydrogenase [EC:1.3.8.8]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00071  Fatty acid degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
Module
sbq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101034499 (ACADL)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101034499 (ACADL)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.8  long-chain acyl-CoA dehydrogenase
     101034499 (ACADL)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 101034499
NCBI-ProteinID: XP_010334805
LinkDB
Position
Unknown
AA seq 344 aa
MPRAVTKQKEYMGKPPDQDKNQSPRWWRPCLKGHRLYSRLGARASPPYEGVVVPRIQFLW
KVGPRPEILEITEGEEALWCDQSPWLYTFDLQGVKTNTKKEGSDWILNGSKVFVSNGWLS
DLVIVVVITNCEAPXPAHGISLFLVENGMKGFIKGQKLQKMGLKAQTSDNDTAELFFEDV
WLPASALLGEENKGFYYLMKXLPQERLLIADXAISASXFMFEETWNYVKQRKAFGKIIAH
LQTVQHKLAELKTHICITRAFVDSCLQLHERKRLDSATACMAKYWTSDLQNSAAYDRVQL
HGGWGCIWEHLTAKAYVEAXVQPIYGGANEIMKELIARDIVCDK
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgcctagagcagtcacaaagcagaaggagtacatgggaaaaccaccagaccaggacaag
aaccaaagtcccaggtggtggcgtccttgcctgaaagggcataggctgtatagtaggctt
ggagcaagagcctctcctccttatgaaggagttgtagtacctcgcatccagttcctgtgg
aaagtaggccccaggcctgaaatcctggaaataactgagggagaagaagccctctggtgt
gaccagtcaccgtggctgtacacttttgacttacaaggagtaaaaacaaatactaagaag
gaaggaagtgactggattctcaatggaagcaaggtgttcgtcagtaatgggtggttaagt
gaccttgtgattgtagttgtgatcacaaattgtgaggctcctncccctgcccatggtatt
agcctttttctggtggaaaatggaatgaaagggtttattaagggacaaaagctacaaaaa
atgggattaaaagcccagacgagtgataatgatactgcagaactattctttgaagatgta
tggttgccagctagtgccctacttggagaagagaataaaggcttctattatctcatgaaa
nngcttccacaggaaaggctactaattgctgatnatgcaatttcagctagttaattcatg
tttgaagaaacctggaactatgttaaacaaagaaaagcttttgggaaaataattgcccac
ctacagacagtgcaacataaattagcagaattaaaaacacacatatgtataaccagagca
tttgtggacagctgtctccagctgcatgaaaggaaacgtttagactctgccactgcttgc
atggcgaaatattggacatctgatttacaaaatagtgcagcttatgaccgtgtacagctc
catggaggttggggatgcatatgggagcacctaactgcaaaagcttatgtggaagcctga
gttcagccaatctatggtggtgcaaatgaaataatgaaggagctgattgcaagagatatt
gtctgtgacaagtag

DBGET integrated database retrieval system