KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034605
Entry
101034605         CDS       T04350                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04340  Hedgehog signaling pathway
sbq04360  Axon guidance
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05217  Basal cell carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101034605 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    101034605 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034605 (SHH)
   05205 Proteoglycans in cancer
    101034605 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    101034605 (SHH)
   05217 Basal cell carcinoma
    101034605 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101034605 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101034605 (SHH)
Peptidases and inhibitors [BR:sbq01002]
 Cysteine peptidases
  Family C46: hedgehog family
   101034605 (SHH)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Morphogens
   101034605 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 101034605
NCBI-ProteinID: XP_010327869
LinkDB
Position
Unknown
AA seq 465 aa
MGEMLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLSYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSD
FLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAWEPESSSGAGPPPGD
APGRRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLREEAAGAYAPLTAQGTILIN
RVLASCYAVIEEHGWAHRAFAPFRLAHALLAALAPARTDRGGDGGGGDGGGGGGRVPPPA
PGAADDPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAAKSS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggcgagatgctgctgctggcgagatgtctgctgctagtcctcgtctcctcgctgctg
gtgtgctcggggctggcgtgcggacccggcagggggttcggaaagaggcggcaccccaaa
aagctgacccctttatcctacaagcagtttatccccaatgtggccgagaagaccctaggc
gccagcggaaggtatgaagggaagatcaccagaaactcggagcgatttaaggaactcacc
cccaattacaaccccgacatcatatttaaggacgaagaaaacaccggagcggacaggctg
atgactcagaggtgtaaggacaagttgaacgccttggccatctctgtgatgaaccagtgg
ccgggagtgaaactgcgggtgaccgagggctgggacgaggatggccaccactcagaggag
tctctgcactacgagggccgcgcagtggacattaccacgtccgaccgcgaccgcagcaag
tacggcatgctggcccgcctggcggtggaggccggcttcgactgggtctactacgagtcc
aaggcgcacatccactgctcggtgaaagcagagaactcggtggcggccaaatccgggggc
tgcttcccgggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggac
ctccgccccggggaccgcgtgctggcggcggacgaccagggccggctgctctacagcgac
ttcctcactttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacg
cgggagccgcgcgagcgcctgctgctcaccgccgcgcacctgctcttcgtggcgccgcac
aatgactcggccgcctgggagcccgagtcgtcctcaggcgcggggccgcctcccggggac
gcgccggggcgccgggcgctgttcgccagccgcgtgcgcccgggccagcgcgtgtacgtg
gtggccgagcgcgatggggaccgccggctcctgcccgccgccgtgcacagcgtgacgctg
cgcgaggaggccgcgggcgcctacgcgccgctcacggcccagggcaccatcctcatcaac
cgggtgctggcctcgtgctacgcggtcatcgaggagcacggctgggcgcaccgggccttc
gcgcccttccgcctggcgcacgcgctcctggctgcattggcgcccgcgcgcacggaccgc
ggcggagacggcggcggcggggacggcgggggcggcggcggccgagttcccccgcccgcc
ccaggtgcggccgacgatccgggcgcgggggccaccgcgggcatccactggtactcgcag
ctgctctaccaaataggcacgtggctcctggacagcgaggccctgcaccccctgggcatg
gcggccaagtccagctga

DBGET integrated database retrieval system