KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034616
Entry
101034616         CDS       T04350                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101034616 (IRF7)
   04621 NOD-like receptor signaling pathway
    101034616 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    101034616 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    101034616 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101034616 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101034616 (IRF7)
   05160 Hepatitis C
    101034616 (IRF7)
   05164 Influenza A
    101034616 (IRF7)
   05162 Measles
    101034616 (IRF7)
   05168 Herpes simplex virus 1 infection
    101034616 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034616 (IRF7)
   05169 Epstein-Barr virus infection
    101034616 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101034616 (IRF7)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    101034616 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 101034616
NCBI-ProteinID: XP_003943408
LinkDB
Position
Unknown
AA seq 515 aa
MEVANPTRLSPPQARCSASRKPPAIPAPSPGSGQLARGRYEGLRWLDEARTRFRVPWKHF
GRKDLSEADARIFKAWAVARGRWPPGSSGGDQPPCEAAERAGWKTNFRCALHSTRRFVML
QDNSGDPADPHKVYTLSQDLGCREGPGTDRTQAEAPMATPPSQAGPPGPFLAQGDAELQA
PSLLPAPAGDQQDLLLQAVWQSCLGGHLLTASWGADPVPAEAPGEGLNELSQTGGCAGDP
GLPAGELFKWAAEATPGPSPQPPALTAGETTAPEPLPQAEPYVAHSPGACTVMGEPSPGV
LDVTITYKGRMVLQQVVGRPSCVFLYGPPGPAIWATDPQPVAFPSPAELPDQKQLRYTEE
LLRHVAPGLQLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNFDTPIFDFR
VFFQELVEFRARRRCSSPRCTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRMYLEGTQRE
GVSSLDSSSLSLCLSSANSLYDVIEGFLMELEQPA
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggaggtggcaaatccaaccaggctgtccccaccccaagcgcgctgcagcgcttcccgt
aaaccacctgctattcccgcgccctccccaggctcgggccagctggcccgcggccgctac
gaggggctgcggtggctggatgaggcccgcacgcgcttccgcgtgccctggaagcacttc
gggcgcaaggacctgagcgaggcggacgcgcgcatcttcaaggcctgggccgtggcccgc
ggcaggtggccccctggcagcagcggaggtgaccagccgccctgcgaggctgcggaacgc
gccggctggaaaaccaacttccgctgcgccctgcacagcacgcgtcgctttgtgatgctg
caagacaactcgggggaccccgcggacccccacaaggtgtacaccctcagccaggacctg
ggctgccgagaaggcccaggcactgaccggacgcaggcagaggcccccatggccacccca
ccgtcccaggctgggcccccagggccattcctagcacaaggagatgctgaactccaagcc
ccaagcctcctccctgccccagccggagaccagcaggacctcctgcttcaggcagtgtgg
cagagctgcctggggggccatctgctgacagcgtcatggggggcagatccagttccagct
gaggctcctggagagggactgaacgagctttcccagactgggggctgtgctggagaccca
gggctccctgctggggagctgttcaagtgggcagcagaggcgaccccaggccccagcccc
cagcccccagccctaactgcaggcgagaccacagccccagagcccctgccccaggcagag
ccatacgtggcccactccccaggtgcctgcactgtgatgggagagcccagcccaggggtg
ctggatgtgaccatcacctacaagggccgcatggtgctgcagcaggtggtggggcgcccg
agctgtgtgttcctgtacggccccccgggcccagccatctgggccacagacccccagcca
gtggcattccccagccctgccgagcttccggaccagaagcagctgcgctacacagaggag
ctgctgcggcacgtggcccccgggctgcagctggagcttcgggggccgcagttgtgggcc
cggcgcatgggcaagtgcaaggtgtactgggaggtgggcggccccccaggctcggccagc
ccctccaccccagcctgtctgctgcctcgcaacttcgacacccccatcttcgacttcaga
gtcttcttccaagagctggtggagttccgggcacggcgccgctgcagctccccacgctgc
accatctacctgggctttggccaggacttgtcagccggaagacccaaggagaagagcctg
gtcctggtgaagctggagccctggctgtgccgaatgtacctggagggcacgcagcgcgag
ggggtgtcttccctggacagcagcagcctcagcctctgcctgtccagcgccaacagcctc
tacgatgtcatcgagggcttcctcatggagctggagcagcccgcctag

DBGET integrated database retrieval system