KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034707
Entry
101034707         CDS       T04350                                 

Gene name
JAK3
Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04062  Chemokine signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04630  JAK-STAT signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq05161  Hepatitis B
sbq05162  Measles
sbq05166  Human T-cell leukemia virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05223  Non-small cell lung cancer
sbq05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034707 (JAK3)
   04151 PI3K-Akt signaling pathway
    101034707 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101034707 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101034707 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101034707 (JAK3)
   04659 Th17 cell differentiation
    101034707 (JAK3)
   04062 Chemokine signaling pathway
    101034707 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034707 (JAK3)
   05203 Viral carcinogenesis
    101034707 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101034707 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    101034707 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034707 (JAK3)
   05161 Hepatitis B
    101034707 (JAK3)
   05162 Measles
    101034707 (JAK3)
   05169 Epstein-Barr virus infection
    101034707 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101034707 (JAK3)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101034707 (JAK3)
Protein kinases [BR:sbq01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   101034707 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kinase-like Kdo APH SH2 LRR_RI_capping
Other DBs
NCBI-GeneID: 101034707
NCBI-ProteinID: XP_003942323
LinkDB
Position
Unknown
AA seq 1181 aa
MTVAQETKGPTQEGAEWDFPLAASRLCPPSERPGSLPAGQAALMAPPSEEMPLIPQRSCS
LLSTEAGALHVLLPARGPGPPQRLSFSYGDHLAEDLCVQAAKASGILPVYHSLFALATED
LSCWFPPSHIFSVEDATTHVLCYRIRFYFPNWCGLEKCHRFGLRKDLASAVLDLPVLEYL
FAQHRSDLVNGRLPVGLSLKEQGECLSLAVLDLARMAREQAQRPGELLKTVSYKACLPPS
LRDLIQGLSFVTRRRIRRTVRRALRRVASCQADRQSLMAKYIMDLERLNPAGAAETFHVG
LPGAPDGQDGLGLLRVTGDRGLAWSPGVQEDLQPFCDFPEIVDISIKQAPRAGPAGEHRL
VTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFCKEVAPPRLLEEVAEQCH
GPITLDFAINKLKTGGSLPGSYVLRRSPQDFDCFLLTVCVQTPLGPDYKGCLIRRSPTGS
FVLAGLSQPYSSLRELLATCWDGGLHVDGVPVTLTSCCIPRPKEKSNLIVVRRGRSPPTS
SLVQPQSQCQLSQMTFHKIPADSLEWHESLGHGSFTKIYRGCRHEAVDGEARKTEVLLKV
MNAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMTGDSTMVQEFVHLGAIDMYLRKRGH
LVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLARDGGDGSPPFIKLSDPGVSPT
VLSLEMLTDRIPWVAPECLREAHTLSLEADKWGFGATVWEVFSGVTMPISALDPAKKLQF
YEDRQQLPAPKWTELALLIQQCMDYEPVRRPSFRAIIRDLNSLISADYELLSDPTPGALA
PRDGLWNGTQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQL
QHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRH
RAHLDASRLLLYASQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLD
KDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFSYCDKSCSPSAEFLRM
MACERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQERPSFSALGPQLDT
LCWSGSRGCETPAFPAHPEGKPHTLCPFYSSCPQTSGLGLC
NT seq 3546 nt   +upstreamnt  +downstreamnt
atgacagtggctcaggaaaccaaggggcccacacaggaaggagccgagtgggactttcct
ctcgctgcctcccggctctgccctccctctgagcgccccggatcgctgcctgccgggcaa
gctgcactcatggcacctccaagcgaagagatgcctctgatcccgcagcgttcctgcagc
ctcttgtccacggaagctggtgccctgcatgtgctgctgcccgctaggggcccaggcccc
ccccagcgcctatctttctcctatggggaccacttggctgaggacctctgtgtgcaggct
gccaaggccagtggcatcctgcctgtgtaccactccctctttgctctggccactgaggac
ctgtcctgctggttccccccaagccacatcttctccgtggaggatgccaccacccatgtc
ctgtgctacaggattcgcttttacttccccaattggtgtgggctggagaagtgccaccgc
tttgggctgcgaaaggatttggccagcgccgtccttgacctgccagtcctggagtacctc
tttgcccagcaccgcagtgacctagtgaatggacgcctccctgtgggcctcagcctcaag
gagcagggtgagtgtctcagcctggccgtgctggacctggcccggatggcgagagagcag
gcccagcggccaggagaactgctgaagactgtcagctacaaggcctgcctaccccccagc
ctgcgcgacctgatccagggcctgagcttcgtgacacggaggcgtattcggaggaccgtg
cgcagggccctgcgccgcgtggcctcctgccaggccgaccggcagtcgctcatggccaag
tacatcatggacctggagcgactgaatccggccggggccgccgagaccttccacgtgggc
ctccccggggcccctgatggccaggacgggctggggctgctccgcgtgacaggtgaccgc
ggcctcgcctggagccctggagtgcaggaggacctccagcccttctgcgactttccagaa
atcgtagacattagcatcaagcaggccccgcgcgctgggccggccggggagcaccgtctg
gtgactgtcaccaggacagacaatcagattttggaggccgagttcccggggctgcccgag
gccctgtcctttgtggcgctggtggacggctacttccggctgaccacggactcccagcac
ttcttctgcaaggaggtggccccgccgaggctgctggaggaggtggccgagcagtgccat
ggccccatcactctggactttgccatcaacaagcttaagaccggaggctcgcttcctggc
tcctatgttctccgccgcagcccccaggactttgactgcttcctcctcactgtttgcgtt
cagacccccctcggtcctgattataagggctgcctcatccggcgcagccccacaggatcc
ttcgttctggctggcctcagccaaccctacagcagtcttcgagagcttctggcaacctgc
tgggatggagggctgcatgtagatggggtcccagtgaccctcacctcctgctgtattccc
agacccaaagaaaagtccaacctgattgtggtccggagaggtcgcagcccacccacgtcc
tccctggttcagccccaatcccagtgccagctgagccagatgacatttcacaagatcccc
gcggacagcctggagtggcatgagagcctgggccacgggtccttcaccaagatttaccgg
ggctgtcgccacgaggcagtggatggggaggcccgaaagacagaggtgctgttgaaggtg
atgaacgccaaacacaagaactgcatggagtcattcctggaagcagcgagcttgatgagc
caagtgtcgtaccggcatctcgtgttactgcacggcgtgtgcatgactggagacagcacc
atggtgcaggaatttgtacacctgggggcaatagacatgtatctgcgcaagcgtggccac
ctggtgccagccagctggaagctacaggtggtcaaacagctggcctatgccctcaactat
ctggaggacaaaggccttccccacggcaatgtctctgcccggaaagtgctcctggctcgg
gacggcggtgatgggagcccgcccttcatcaagctgagtgaccctggggtcagccccact
gtgctaagcctggagatgctcaccgacaggattccctgggtggcccccgagtgcctccga
gaggcccacacacttagcctggaagctgacaagtggggcttcggcgccaccgtctgggag
gtgtttagtggcgtcaccatgcccatcagcgccctggatcccgctaagaaactccagttt
tatgaggatcggcagcagctgccggcccccaagtggacagagctggccctgctcattcag
cagtgcatggactacgagccagtccggagaccctcctttcgagccatcatccgtgacctc
aacagcctcatctctgcggattatgagctcctctcagaccccacacctggtgccctggca
cctcgtgatgggctgtggaatggtacccagctctatgcctgccaagaccccacgatcttt
gaggagagacacctcaagtacatctcacagctgggcaagggcaacttcggcagtgtggag
ctgtgccgctacgacccgctaggcgacaacacaggtgccctggtggccgtgaaacagctg
cagcacagcgggccagaccagcagagggacttccagcgggagatccagatcctcaaagcg
ctgcacagcgacttcattgtcaagtaccgtggtgtcagctatggcccgggccgccagagc
ctgcgtctggtcatggagtacctgcccagcggctgcctgcgcgacttcctgcagcggcat
cgcgcgcatctcgatgccagccggctcctcctctatgcctcgcagatctgcaagggcatg
gagtacctgggctcccgccgctgcgtgcaccgcgacctggccgcccggaacatcctagtg
gagagcgaggcacacgtcaagatcgctgacttcggcctagccaagctgctgcccctggat
aaagactactacgtggtccgcgagccgggccagagccccattttctggtatgcccccgag
tccctctcggacaacatattctctcgccagtccgacgtctggagcttcggggttgtcctg
tacgagctcttcagctactgcgacaaaagctgcagcccctcggccgagttcctgcggatg
atggcctgtgagcgggatgtccccgccctctgccgcctcctggaactgctggaagagggc
cagaggctgccggcgcctcctgcctgccctgctgaggttcacgagctcatgaagctgtgc
tgggcccctagcccacaggagcggccgtcattcagtgccctgggcccccagctggacacg
ctgtgttggagtggaagccgggggtgtgagactcctgccttccctgctcacccagagggc
aaaccccacactctctgtcctttttatagctcctgtccgcagacctctggactaggtctc
tgttga

DBGET integrated database retrieval system