KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034757
Entry
101034757         CDS       T04350                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01523  Antifolate resistance
sbq04060  Cytokine-cytokine receptor interaction
sbq04061  Viral protein interaction with cytokine and cytokine receptor
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04640  Hematopoietic cell lineage
sbq04657  IL-17 signaling pathway
sbq04659  Th17 cell differentiation
sbq04668  TNF signaling pathway
sbq04672  Intestinal immune network for IgA production
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05010  Alzheimer disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05144  Malaria
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05321  Inflammatory bowel disease
sbq05323  Rheumatoid arthritis
sbq05332  Graft-versus-host disease
sbq05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101034757 (IL6)
   04668 TNF signaling pathway
    101034757 (IL6)
   04066 HIF-1 signaling pathway
    101034757 (IL6)
   04068 FoxO signaling pathway
    101034757 (IL6)
   04151 PI3K-Akt signaling pathway
    101034757 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101034757 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101034757 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101034757 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101034757 (IL6)
   04620 Toll-like receptor signaling pathway
    101034757 (IL6)
   04621 NOD-like receptor signaling pathway
    101034757 (IL6)
   04623 Cytosolic DNA-sensing pathway
    101034757 (IL6)
   04625 C-type lectin receptor signaling pathway
    101034757 (IL6)
   04659 Th17 cell differentiation
    101034757 (IL6)
   04657 IL-17 signaling pathway
    101034757 (IL6)
   04672 Intestinal immune network for IgA production
    101034757 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034757 (IL6)
   05202 Transcriptional misregulation in cancer
    101034757 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101034757 (IL6)
   05321 Inflammatory bowel disease
    101034757 (IL6)
   05332 Graft-versus-host disease
    101034757 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101034757 (IL6)
   05020 Prion disease
    101034757 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    101034757 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101034757 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101034757 (IL6)
   04931 Insulin resistance
    101034757 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101034757 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101034757 (IL6)
   05135 Yersinia infection
    101034757 (IL6)
   05133 Pertussis
    101034757 (IL6)
   05134 Legionellosis
    101034757 (IL6)
   05152 Tuberculosis
    101034757 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034757 (IL6)
   05161 Hepatitis B
    101034757 (IL6)
   05171 Coronavirus disease - COVID-19
    101034757 (IL6)
   05164 Influenza A
    101034757 (IL6)
   05162 Measles
    101034757 (IL6)
   05168 Herpes simplex virus 1 infection
    101034757 (IL6)
   05163 Human cytomegalovirus infection
    101034757 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034757 (IL6)
   05169 Epstein-Barr virus infection
    101034757 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101034757 (IL6)
   05144 Malaria
    101034757 (IL6)
   05142 Chagas disease
    101034757 (IL6)
   05143 African trypanosomiasis
    101034757 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101034757 (IL6)
   01523 Antifolate resistance
    101034757 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101034757 (IL6)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Interleukins
   101034757 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 GCSF
Other DBs
NCBI-GeneID: 101034757
NCBI-ProteinID: XP_003935160
UniProt: A0A2K6T464
LinkDB
Position
Unknown
AA seq 212 aa
MNSLSTSAFRPVAFSLGLLLVMPAAFPAPVTLGEDSKEVAAPNRQLLTSTERIDKHIWYI
LDGISALRKEICNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLLKITTGLL
EFEVYLEYLQNRFESSKEQAGAVQMSTKGLIQSLQRKAKNLSAIATPDPATNASLLTKLQ
AQDQWLQGVTTHLILRSFKEFLQCSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactctctctccacaagcgccttcagaccagttgccttctccctggggctgctcctg
gtgatgcctgctgccttccctgccccagtaaccctgggagaagattccaaagaggtagcc
gccccaaaccgacagctactcacctccacagaacgaattgacaaacacatttggtacatc
ctcgacggcatctcagccttgagaaaggagatatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggcagaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctgctgaaaatcaccactggtcttttg
gagtttgaagtatacctagagtacctccagaacaggtttgagagtagcaaggaacaagct
ggagctgtgcagatgagtacaaaaggcctgatccagtcactgcagagaaaggcaaagaat
ctaagtgcaatagccacccctgacccagccacaaatgccagcctgctgacgaagctgcag
gcacaggaccagtggctgcagggcgtgacgacgcatctcatcctgcgcagctttaaggag
ttcctgcagtgcagtctgcgggctctgcggcaaatgtag

DBGET integrated database retrieval system