KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034824
Entry
101034824         CDS       T04350                                 

Gene name
KIF5A
Definition
(RefSeq) kinesin heavy chain isoform 5A
  KO
K10396  kinesin family member 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04144  Endocytosis
sbq04728  Dopaminergic synapse
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101034824 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    101034824 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101034824 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101034824 (KIF5A)
   05012 Parkinson disease
    101034824 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    101034824 (KIF5A)
   05016 Huntington disease
    101034824 (KIF5A)
   05020 Prion disease
    101034824 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    101034824 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101034824 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101034824 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101034824 (KIF5A)
   04147 Exosome [BR:sbq04147]
    101034824 (KIF5A)
Membrane trafficking [BR:sbq04131]
 Others
  Actin-binding proteins
   Others
    101034824 (KIF5A)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     101034824 (KIF5A)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101034824 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16 Spc7
Other DBs
NCBI-GeneID: 101034824
NCBI-ProteinID: XP_003926525
UniProt: A0A2K6TR51
LinkDB
Position
Unknown
AA seq 1032 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDAEEVKKALEMQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
ATPSSSSDMYFANSCTSSGAPSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcggagaccaacaacgaatgtagcatcaaggtgctctgccgattccggcccctgaac
caggctgagattctgcggggagacaagttcatccccattttccaaggggacgacagcgtc
gttattggggggaagccatatgtttttgaccgtgtattccccccaaacacgactcaggag
caagtttatcatgcatgtgccatgcagattgtcaaagatgtccttgctggctacaatggc
accatttttgcttatgggcagacatcctcagggaaaacacataccatggagggaaagctg
cacgacccccagctgatgggaatcattcctcgaattgcccgagacatcttcaaccacatc
tactccatggatgagaaccttgagttccacatcaaggtttcttactttgaaatttatctg
gacaaaattcgtgaccttctggatgtgaccaagacaaatttgtctgtgcacgaggacaag
aaccgggtaccatttgtcaagggttgtactgaacgctttgtgtccagcccagaagagatt
cttgatgtgattgatgaaggcaaatcaaatcgtcatgtggctgtcaccaacatgaatgaa
cacagctctcggagccacagcatcttcctcatcaacatcaagcaggagaacatggaaaca
gagcagaagctcagtgggaagctgtatctggtggacctggcagggagtgagaaggtcagc
aagactggagcagagggagccgtgctggacgaggcaaagaatatcaacaagtcactgtca
gccctggggaatgtgatctccgcgctggctgagggcactaaaagctatgttccatatcgt
gacagcaaaatgacaaggattctccaggactctctggggggaaactgccggacaactatg
ttcatctgttgctcgccgtccagttacaatgatgcagagacgaagtccacgctgatgttt
gggcagcgtgcaaagaccattaagaacaccgcctcagtgaatctggagttgactgctgag
cagtggaagaagaaatatgagaaggagaaggagaagacaaaggcccagaaggagacaatt
gcgaagctggaggcagagctgagccggtggcgcaatggagagaatgtgcccgagacggag
cgcctggctggggaggaggcagccctgggggctgagctctgcgaggagacccctgtgaat
gacaactcatccattgtggtgcgcattgcgcctgaggagcggcagaaatatgaggaggag
atccgccgcctctacaagcagctcgacgacaaggatgatgaaatcaaccagcaaagccaa
ctcatagagaagctcaagcagcaaatgctggaccaggaagagctgctggtgtccacccga
ggagacaatgagaaggtccagcgtgagctgagccacctgcaatcagagaacgatgctgct
aaggatgaggtaaaggaagtgctgcaggccctggaggagctggctgtgaactacgaccag
aagtcccaggaggtggaggagaagagtcagcagaaccagcttctggtggatgagctgtct
cagaaggtggccaccatgctgtccctggagtccgagttgcagcggctacaggaggtcagc
ggacaccagcgaaaacgaattgctgaggtgctgaacgggctgatgaaggatctcagcgag
ttcagtgtcattgtgggcaatggagagattaaactgccagtggagatcagtggggccatc
gaggaggagttcactgtggcccgactctacatcagcaaaatcaaatcagaagtcaagtct
gtggtcaagcggtgtaggcagctggagaacctccaggtggaatgtcaccgcaagatggaa
gtgactgggcgggagctctcatcctgccagctcctcatctcccagcacgaggccaagatc
cgctcgcttacggaatacatgcagagtgtggagctcaagaagcggcacctggaagagtcc
tatgactccttgagtgatgagctggccaagctccaggcccaggaaactgtgcatgaagtg
gccctgaaggacaaggagcccgacacacaggatgcagaagaagtgaagaaggctctggag
atgcagatggagagccaccgggaggcccatcaccggcagctggcccggctccgggacgag
atcaacgagaagcagaagaccattgatgagctcaaagacctcaatcagaagctccagtta
gagctagagaagcttcaggctgactatgagaagctgaagagtgaagaacatgagaagagc
accaaactccaggagctgacatttctgtacgagcgacatgagcagtccaagcaggacctc
aagggtctggaggagacagttgcccgggaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaagacagt
ggggggattcactcccaaaagcagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ctggaaaaacgacttagggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgccatgaaggacaagcgccggtaccagcaggaggtggaccgcatc
aaggaggctgttcgctacaagagctcgggcaagcggggccattctgcccagattgccaaa
cccgtccggcctggccactacccagcatcctcacccaccaacccctatggcacccggagc
cctgagtgcatcagttacaccaacagcctcttccagaactaccagaatctctacctgcag
gccacacccagctcctcctcagacatgtactttgctaactcctgtaccagcagtggagcc
ccatcttctggtggccccttggcttcctaccagaaagccaacatggacaatggaaatgcc
acagacatcaatgacaataggagtgacctgccttgtggctacgaagctgaggaccaggcc
aagcttttccctctccaccaagagacagcagccagctaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042531
Entry
101042531         CDS       T04350                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin-1 heavy chain
  KO
K10396  kinesin family member 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04144  Endocytosis
sbq04728  Dopaminergic synapse
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101042531 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    101042531 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101042531 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101042531 (KIF5B)
   05012 Parkinson disease
    101042531 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    101042531 (KIF5B)
   05016 Huntington disease
    101042531 (KIF5B)
   05020 Prion disease
    101042531 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    101042531 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101042531 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101042531 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101042531 (KIF5B)
   04147 Exosome [BR:sbq04147]
    101042531 (KIF5B)
Membrane trafficking [BR:sbq04131]
 Others
  Actin-binding proteins
   Others
    101042531 (KIF5B)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     101042531 (KIF5B)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101042531 (KIF5B)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin ERM
Other DBs
NCBI-GeneID: 101042531
NCBI-ProteinID: XP_003938427
UniProt: A0A2K6V6G4
LinkDB
Position
Unknown
AA seq 963 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVVIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFTVDKDIAITNDKPTTTIGVTGNFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLNEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMMLEQERLRVEHEKLKATDQEKSRKLHELTVIQDRREQAKQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGG
KQV
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcggacccggccgagtgcaacatcaaagtgatgtgtcgcttcagacctctcaacgag
tctgaggtgaaccgcggcgacaagtacgtcgccaagtttcagggagaagacacggtcgtg
atcgcgtccaagccttatgcatttgatcgggtgttccagtcaagcacatctcaagagcaa
gtgtataatgactgtgcaaagaagattgttaaagatgtacttgaaggatataatggaaca
atatttgcatatggacaaacatcctctgggaagacacacacaatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttggaatttcatattaaggtttcatattttgaaatatatttggat
aagataagggacctattagatgtttcaaagaccaacctttcagttcatgaagacaaaaac
cgagttccctatgtaaaggggtgcacagaacgttttgtatgtagtccagatgaagttatg
gataccatagatgaaggaaaatccaacagacatgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttattaatgtaaaacaagagaacacacaaacggaa
caaaagctgagtggaaaactttatctggttgatttagctggtagtgaaaaggttagtaaa
actggagctgaaggtgctgtgctagatgaagctaaaaacatcaacaagtcactttctgct
cttggaaatgtcatttctgctttggctgagggtagtacgtatgttccgtatcgagatagt
aaaatgacaagaatccttcaagattcattaggtggcaactgtagaaccactattgtaata
tgctgctctccatcatcatacaatgagtctgaaacaaaatctacactcttatttggccaa
agggccaaaacaattaagaacacagtctgtgtcaatgtagagttaactgccgaacagtgg
aaaaagaagtatgaaaaagaaaaagaaaaaaataagaccctgcggaacactattcagtgg
cttgaaaatgaactcaacagatggcgtaatggggagactgtgcctattgatgaacagttt
gacaaagagaaagccaacttggaagctttcacagtggataaagatattgctattaccaat
gataaaccaacaaccacaattggagttacaggaaattttactgatgctgaaagaagaaag
tgtgaagaagaaattgccaaattatacaaacagcttgatgacaaggatgaagaaattaac
cagcaaagtcaactagtagagaaactgaagacacagatgttggatcaggaagagcttttg
gcatctaccagaagggatcaagacaatatgcaagctgagctgaatcgccttcaagcagaa
aatgatgcctctaaagaagaagtgaaagaagttttacaggccctagaagaacttgctgtc
aattatgatcagaagtctcaggaagttgaagacaaaactaaggaatatgaattgcttagt
gacgaactgaatcagaaatcagcaactttagcgagtatagatgctgagcttcagaaactt
aaggaaatgaccaaccatcagaaaaaacgggcagctgagatgatggcatctttactaaaa
gaccttgcagaaataggaattgctgtgggaaataatgacgtaaagcagcctgagggaact
ggcatgatagatgaagagttcactgttgcaaggctctacattagcaaaatgaagtcagaa
gtaaaaaccatggtgaaacgctgcaagcagttagaaagcacacaaactgagagcaacaaa
aaaatggaagaaaatgaaaaggagttagctgcatgtcagcttcgtatctctcaacatgaa
gccaaaatcaagtcattgactgaataccttcaaaatgtggaacaaaagaaaagacagctg
gaggaatctgttgattctctcaatgaagaactagtccagcttcgagcacaagagaaagtc
catgaaatggaaaaggagcacttaaataaggttcagactgcaaatgaagttaagcaagct
gttgaacagcagatccaaagccacagagaaactcatcaaaaacaaatcagtagtttgaga
gatgaagtagaagcaaaagaaaaacttattactgatcttcaagaccaaaaccagaaaatg
atgttagagcaggaacgtctaagagtagaacatgagaagttgaaagctacagatcaggaa
aagagcagaaaactacatgagcttacggttatacaagatagaagagaacaagcaaaacaa
gacttgaagggtttggaagagacagtggcaaaagaacttcagactttacacaatctgcgc
aagctctttgttcaggacctggctaccagagttaaaaagagtgctgagattgattctgat
gacaccggaggcagcgctgctcagaagcaaaaaatctcctttcttgaaaataatcttgaa
cagctcactaaagtgcacaaacagttggtacgtgataatgcagatctccgctgcgaactt
cctaagttggaaaagcgacttcgagctacagctgagagagtgaaagctttggaatcagcg
ttgaaagaagccaaagaaaatgcatctcgtgatcgcaaacgctatcagcaagaagtagat
cgcataaaagaagcagtcaggtcaaagaatatggccagaagagggcattctgctcagatt
gctaaacctattcgtcccgggcaacatccagcagcttctccaactcatccaagtgcaatt
cgtggaggaggtgcatttgttcagaacagccagccagtggcagttcgaggtggaggaggc
aaacaagtgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053966
Entry
101053966         CDS       T04350                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04020  Calcium signaling pathway
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
sbq05223  Non-small cell lung cancer
sbq05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101053966 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101053966 (RET)
   05230 Central carbon metabolism in cancer
    101053966 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101053966 (RET)
   05223 Non-small cell lung cancer
    101053966 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101053966 (RET)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101053966 (RET)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  RET family
   101053966 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 101053966
NCBI-ProteinID: XP_003930063
LinkDB
Position
Unknown
AA seq 1135 aa
MRTFSEDLDSEDALSTNILEAVVHKKGLPRNHPDLDNSIEMQEVPPHWAALGHLDWWLVW
LQAARTAAPFAAQKPYPHHPSLTSLLPTVALGLYFSRDAYWENLYVDQPAGMPLLYVHAL
RDTPGEVPSFHLGRHLYGTYHTRLHENNWIRIQEDTGLLYLNRSLDQRTWKKLSVRNGGF
RVFTVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPQELCFPEKSLYFRI
RENRPPGTFHQFRLLPVQFLCPNISVTYRLLEGEGLPFRCASDSLEVSTRWALDREQREK
YQLVAVCTVRAGAREEVEMVPFLVSVYDEDDSAPTFPAGVDTASALVEFKRKKDTVVATL
RVFDADVVPASGELVRRYTSTLLPRDTWAQQTFRVEHWPNETLVQANGSFVRATVHDYRL
VLNRNLSIAENRTMQLAVLVNDSDFQGPGAGVVLLHFNVSVLPISLHLPSTSFSVSRRAH
RFAQIGKVCVENCQAFSGINVQYELHASGANCSTLGVVTSAADTSGILFVNDTKALRRPK
CAELQYMVVATDQQTCRQAQAQLLVTVVGSYITEEVGCPLSCAVSKRRLECEECGGLGAL
TGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVEAQDINICPQDCLRVSIVGGHEPG
EPRGIKAGYGTCNCFPEEKKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCI
HRYHKFAHKPPVSSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKW
EFPRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFN
LLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYVGSGGSRNSSS
LDHPDERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSR
DVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPP
ERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLD
LAASTPSDSLLYDDGLSEEEMPLVDCNNAPLPRALPSTWIENKLYGRISHAFTRF
NT seq 3408 nt   +upstreamnt  +downstreamnt
atgaggacattctcagaagacctggactctgaggacgcattgagcacaaacatcctggaa
gccgtggtgcataagaaggggctgcccaggaaccaccctgacctggataacagcatcgag
atgcaggaggtgcccccacattgggctgccctggggcatctggattggtggcttgtctgg
ctccaggctgccaggacagccgctccttttgctgctcaaaagccttatcctcaccatcct
tcactcacttccctacttcccacagtggccctaggcctctacttctcaagggatgcttac
tgggagaatctgtacgtggaccagccggccggcatgcccttgctctacgtgcatgccctg
cgggacactcctggggaggtgcccagcttccacctgggccggcacctctatggcacatac
cacacccggctgcacgagaacaactggatccgcattcaggaagacaccggcctcctctac
cttaaccggagcctggaccagagaacctggaagaagctcagtgtccgcaacggaggtttc
cgggtgttcaccgtctacctcaaggtcttcctgtcacccacgtcccttcgtgagggcgag
tgccagtggccaggctgtgcccgagtgtacttctccttcttcaacacctcctttccggcc
tgcagctccctcaagccccaggagctctgcttcccagagaaaagcctctacttccgcatt
cgtgagaaccggcccccaggcaccttccaccagttccgcctgctgcctgtgcagttcttg
tgccccaacatcagcgtgacctacaggctcctggagggtgagggtctgcccttccgctgc
gcttcggacagcctggaggtgagcacgcgctgggccctggaccgcgagcagcgggagaag
taccagctggtggccgtgtgcaccgtgcgcgccggtgcgcgcgaggaggtggagatggtg
cccttcctggtgagcgtgtacgacgaggacgactcggcgcccaccttccccgcgggcgtc
gacaccgccagcgccttggtggagttcaagcggaagaaggacaccgtggtggccacactg
cgtgtctttgatgcggacgtggtgcctgcatcgggggagctggtgagacggtacacaagc
acgctgctccccagggatacctgggcccagcagaccttccgggtggaacactggcccaac
gagaccttggtccaggctaacggcagcttcgtgcgggcgaccgtgcacgactataggctg
gttctcaaccggaacctctccatcgcggagaaccgcaccatgcagctggccgtgctggtc
aatgactcggacttccagggcccgggggcgggcgtcgtcctgctccacttcaacgtgtca
gtgctgcccatcagcctgcacctgcccagtacctccttctccgtgagcaggagggctcac
cgatttgcccagatcgggaaagtctgtgtggaaaactgccaggcgttcagtggcatcaat
gtccagtatgagctccatgcctccggcgccaactgcagcactctaggggtggtcacctcg
gcggcggacacctcggggatcctgttcgtgaatgacaccaaagccctgcggcggcccaag
tgtgccgaactccagtacatggtggtggccacggaccagcagacctgcaggcaggcccag
gcccagctgctggtcacagtggtggggtcatacattactgaggaggtgggctgccccctg
tcctgtgcggtcagcaagagacggctggagtgtgaggagtgcggcggcctgggtgctctg
acgggcaggtgtgagtggaggcagggagacggcaaaggcatcaccaggaacttctccacc
tgctctcccagcaccaagacctgccctgacggccactgcgatgtggtggaggcccaagac
atcaacatctgcccccaggactgcctccgggtcagcattgtcggggggcatgaacctgga
gagccccgagggattaaagccggttacggcacctgcaactgcttccctgaggagaagaag
tgcttctgcgagccggaagacatccaggatccgctgtgtgacgagctgtgccgcacggtg
atcgcggctgctgtcctcttctccttcatcgtctcggtgctgctgtctgccttctgcatc
catcgctaccacaagtttgcccacaagccgcccgtctcctcagctgagatgaccttccgc
cggccagcccaggccttcccggtcagctactcttcatccggcgcccgccggccctcgctg
gactccatggagaaccaggtctccgtggacgccttcaagatcccggaggatccaaaatgg
gaattccctcgaaagaacttggttcttggaaaaactctaggagaaggtgaatttggaaaa
gtggtcaaggcgacggccttccgtctgaaaggcagagcagggtacaccacagtggccgtg
aagatgctgaaagagaacgcctccccaagtgagctgcgagacctgctgtcagagttcaac
ctcttgaagcaggtcaaccacccacatgtcatcaaactgtatggggcctgcagccaggac
ggcccgcttctcctcatcgtggagtacgccaagtacggctcccttcgaggcttcctccgc
gagagccgaaaggtggggcccggctacgtgggcagcggaggcagccgcaactccagctcc
ctggaccacccggacgagcgggccctcaccatgggcgacctcatctcgtttgcctggcag
atctcacgggggatgcagtacctggccgagatgaagctagtccatcgggacctggcagcc
agaaacatcctggtagctgaggggcggaagatgaagatttctgatttcgggctgtcccga
gatgtttatgaagaggactcctacgtgaagaggagcaagggtcggattccagttaaatgg
atggcaattgagtccctttttgatcatatttacaccacccaaagtgatgtgtggtctttt
ggtgtcctgctgtgggagatcgtgacccttggaggcaacccctatcctgggattcctcct
gagcggctcttcaaccttctgaagaccggccaccggatggagaggccagacaactgcagc
gaggagatgtaccgcctgatgctgcagtgctggaagcaggagccagacaaaaggccggtg
tttgcggacatcagcaaagacctggagaagatgatggttaagagcagagactacctggac
cttgcagcgtccactccatccgactccctgctttatgacgatggcctctcagaggaggag
atgcccctggtggactgtaataatgcccccctccctcgagccctcccttccacatggatt
gaaaacaaactctatggtagaatttcccatgcatttactagattctag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101054225
Entry
101054225         CDS       T04350                                 

Gene name
KIF5C
Definition
(RefSeq) kinesin heavy chain isoform 5C
  KO
K10396  kinesin family member 5
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04144  Endocytosis
sbq04728  Dopaminergic synapse
sbq05010  Alzheimer disease
sbq05012  Parkinson disease
sbq05014  Amyotrophic lateral sclerosis
sbq05016  Huntington disease
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101054225 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    101054225 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    101054225 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101054225 (KIF5C)
   05012 Parkinson disease
    101054225 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    101054225 (KIF5C)
   05016 Huntington disease
    101054225 (KIF5C)
   05020 Prion disease
    101054225 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    101054225 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101054225 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101054225 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101054225 (KIF5C)
   04147 Exosome [BR:sbq04147]
    101054225 (KIF5C)
Membrane trafficking [BR:sbq04131]
 Others
  Actin-binding proteins
   Others
    101054225 (KIF5C)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     101054225 (KIF5C)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101054225 (KIF5C)
SSDB
Motif
Pfam: Kinesin
Other DBs
NCBI-GeneID: 101054225
NCBI-ProteinID: XP_010328598
UniProt: A0A2K6S5Z5
LinkDB
Position
Unknown
AA seq 862 aa
MEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLA
VHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQ
ENVETEKKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKT
HVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNL
ELTAEEWKKKYEKEKEKNKTLKNVIQHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDN
TPIIDNIAPVVAGISTEDKEKYDEEISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDEL
LASTRRDYEKIQEELTRLQIENEAAKDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQL
TDELAQKTTTLTTTQRELSQLQELSNHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLAD
VNGVIEEEFTMARLYISKMKSEVKSLVNRSKQLESAQMDSNRKMNASERELAACQLLISQ
HEAKIKSLTDYMQNMEQKRRQLEESQDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQD
AEEMKKALEQQMESHREAHQKQLSRLRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNK
LKIEDQEREMKLEKLLLLNDKREQAREDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKK
SVELDSDDGGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAER
VKALESALKEAKENAMRDRKRYQQEVDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASS
PTAVHAIRGGGGSSSNSTHYQK
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggaggggaagctgcatgacccccagctcatggggatcatcccaagaattgcccatgat
atctttgaccatatctactccatggatgagaatctggagtttcacataaaggtttcctat
tttgagatctacttggacaaaataagggacttacttgatgtatccaagaccaacttggct
gttcatgaagataaaaacagagtcccgtatgtaaaggggtgcaccgagcggtttgtgtcg
agccccgaggaagtcatggatgtgatagatgaaggcaaagcaaaccgacacgtggctgtg
acaaacatgaatgaacacagctctagaagtcacagtatcttcctgataaatattaagcaa
gagaatgtagagactgaaaaaaaactcagtgggaaactttatttggttgatttggctggg
agtgaaaaggtcagcaaaactggtgccgagggagctgttctcgacgaagctaaaaatatc
aataagtctttgtctgctcttggaaatgtaatctctgctttggcagaagggacaaaaaca
cacgtgccataccgggacagcaagatgactcggattctccaggactctttgggtgggaac
tgcagaacgaccattgtcatttgctgttctccttctgttttcaatgaggctgagaccaag
tccacgctgatgtttggacagagagctaagaccatcaagaatacagtctctgtgaaccta
gaactgacagcagaagaatggaagaagaaatatgaaaaagagaaagagaaaaacaagact
ttgaagaatgttatccagcatctggagatggagctaaacaggtggaggaatggagaagct
gtgcctgaggatgaacagatcagtgccaaggaccagaagaacctggagccttgtgataac
acccccatcattgacaatattgctcctgttgttgctggcatctctacagaggataaagag
aagtacgacgaggagatctccagtctctacagacaattggatgacaaggatgatgaaatt
aatcagcagagccagctggctgaaaagctgaagcaacagatgttggatcaggatgagctt
ttagcttccacaagaagagactatgagaagatacaagaggagctgacacgtctccagatt
gaaaatgaggcagccaaggatgaggtgaaagaagttctccaggccctagaggagctggct
gtcaattacgaccagaaatcacaggaagtggaggataagacccgggccaatgagcagctg
acagacgagctggcccagaaaacgactacattgacaaccacgcagagagagctgagccag
ctgcaagagcttagcaaccaccagaagaaaagagcaactgagatcctgaatttgctgttg
aaagatttgggggagataggtggaataattggcaccaatgatgtgaaaaccttggcagat
gtgaatggagtcatcgaggaggagtttaccatggcccgcctgtacatcagcaagatgaag
tcagaggtcaagtccttggtgaaccgcagcaaacagcttgagagcgcccagatggactcc
aacaggaagatgaacgccagtgagcgggagctggcagcatgccagctgctcatctcacag
cacgaagccaagatcaagtctctgacagactacatgcagaacatggaacagaagaggagg
cagttagaagagtcccaggactcgctcagtgaagagctggccaagctccgagcccaagaa
aaaatgcacgaagtcagcttccaggataaggagaaggaacatctgacgcggttgcaggat
gcggaggaaatgaagaaggcgctggagcagcagatggagagccaccgggaagcgcaccag
aagcagctgtccagactccgagacgaaattgaggagaagcagaaaatcattgatgaaatt
cgggatttgaatcagaaactgcaactggaacaggagaagctcagttctgattataacaag
ctgaaaatagaggaccaagagagagaaatgaaactggaaaagctcttattgctgaatgat
aaaagggaacaagccagagaagacctcaaagggctggaggagacagtgtctcgagaattg
cagacgcttcacaaccttcggaaactctttgtccaggatctgaccacccgagttaaaaaa
agtgtggagttggacagcgatgatggagggggcagtgctgcccagaagcagaaaatttcc
tttttggagaataacctggagcagctcaccaaggttcacaagcagctggtccgggacaac
gcagacctgcgctgcgaactgcccaagctggagaagcggctgcgcgccacggctgagcgt
gtcaaggcgctggagagcgcgctgaaggaggccaaggagaacgccatgcgggaccgcaag
cgctaccagcaggaggtggatcgcatcaaggaggctgtgcgggccaagaacatggccagg
agggcccattcagcccagatcgccaagcccatccggcccggacactacccagcctcatct
ccaacggctgtccatgccattcgagggggaggaggcagctcttcaaactccactcactac
cagaaataa

DBGET integrated database retrieval system