KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101034861
Entry
101034861         CDS       T04350                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101034861 (AKT1)
   04012 ErbB signaling pathway
    101034861 (AKT1)
   04014 Ras signaling pathway
    101034861 (AKT1)
   04015 Rap1 signaling pathway
    101034861 (AKT1)
   04370 VEGF signaling pathway
    101034861 (AKT1)
   04371 Apelin signaling pathway
    101034861 (AKT1)
   04630 JAK-STAT signaling pathway
    101034861 (AKT1)
   04668 TNF signaling pathway
    101034861 (AKT1)
   04066 HIF-1 signaling pathway
    101034861 (AKT1)
   04068 FoxO signaling pathway
    101034861 (AKT1)
   04072 Phospholipase D signaling pathway
    101034861 (AKT1)
   04071 Sphingolipid signaling pathway
    101034861 (AKT1)
   04024 cAMP signaling pathway
    101034861 (AKT1)
   04022 cGMP-PKG signaling pathway
    101034861 (AKT1)
   04151 PI3K-Akt signaling pathway
    101034861 (AKT1)
   04152 AMPK signaling pathway
    101034861 (AKT1)
   04150 mTOR signaling pathway
    101034861 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101034861 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    101034861 (AKT1)
   04218 Cellular senescence
    101034861 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101034861 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101034861 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101034861 (AKT1)
   04613 Neutrophil extracellular trap formation
    101034861 (AKT1)
   04620 Toll-like receptor signaling pathway
    101034861 (AKT1)
   04625 C-type lectin receptor signaling pathway
    101034861 (AKT1)
   04660 T cell receptor signaling pathway
    101034861 (AKT1)
   04662 B cell receptor signaling pathway
    101034861 (AKT1)
   04664 Fc epsilon RI signaling pathway
    101034861 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    101034861 (AKT1)
   04062 Chemokine signaling pathway
    101034861 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101034861 (AKT1)
   04922 Glucagon signaling pathway
    101034861 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    101034861 (AKT1)
   04920 Adipocytokine signaling pathway
    101034861 (AKT1)
   04929 GnRH secretion
    101034861 (AKT1)
   04915 Estrogen signaling pathway
    101034861 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    101034861 (AKT1)
   04917 Prolactin signaling pathway
    101034861 (AKT1)
   04926 Relaxin signaling pathway
    101034861 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    101034861 (AKT1)
   04919 Thyroid hormone signaling pathway
    101034861 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101034861 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101034861 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    101034861 (AKT1)
   04728 Dopaminergic synapse
    101034861 (AKT1)
   04722 Neurotrophin signaling pathway
    101034861 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101034861 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    101034861 (AKT1)
   04213 Longevity regulating pathway - multiple species
    101034861 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101034861 (AKT1)
   05205 Proteoglycans in cancer
    101034861 (AKT1)
   05230 Central carbon metabolism in cancer
    101034861 (AKT1)
   05231 Choline metabolism in cancer
    101034861 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101034861 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101034861 (AKT1)
   05212 Pancreatic cancer
    101034861 (AKT1)
   05225 Hepatocellular carcinoma
    101034861 (AKT1)
   05226 Gastric cancer
    101034861 (AKT1)
   05214 Glioma
    101034861 (AKT1)
   05221 Acute myeloid leukemia
    101034861 (AKT1)
   05220 Chronic myeloid leukemia
    101034861 (AKT1)
   05218 Melanoma
    101034861 (AKT1)
   05211 Renal cell carcinoma
    101034861 (AKT1)
   05215 Prostate cancer
    101034861 (AKT1)
   05213 Endometrial cancer
    101034861 (AKT1)
   05224 Breast cancer
    101034861 (AKT1)
   05222 Small cell lung cancer
    101034861 (AKT1)
   05223 Non-small cell lung cancer
    101034861 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101034861 (AKT1)
   05017 Spinocerebellar ataxia
    101034861 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101034861 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101034861 (AKT1)
   04931 Insulin resistance
    101034861 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101034861 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101034861 (AKT1)
   05135 Yersinia infection
    101034861 (AKT1)
   05152 Tuberculosis
    101034861 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101034861 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    101034861 (AKT1)
   05161 Hepatitis B
    101034861 (AKT1)
   05160 Hepatitis C
    101034861 (AKT1)
   05164 Influenza A
    101034861 (AKT1)
   05162 Measles
    101034861 (AKT1)
   05168 Herpes simplex virus 1 infection
    101034861 (AKT1)
   05163 Human cytomegalovirus infection
    101034861 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101034861 (AKT1)
   05169 Epstein-Barr virus infection
    101034861 (AKT1)
   05165 Human papillomavirus infection
    101034861 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101034861 (AKT1)
   05142 Chagas disease
    101034861 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101034861 (AKT1)
   01524 Platinum drug resistance
    101034861 (AKT1)
   01522 Endocrine resistance
    101034861 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101034861 (AKT1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101034861 (AKT1)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101034861 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101034861
NCBI-ProteinID: XP_003933397
UniProt: A0A2K6SGS8
LinkDB
Position
Unknown
AA seq 480 aa
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPRHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIAWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcggccacgttacttcctcctcaagaatgacggcaccttcattggctacaaggaa
cggccgcaggacgtggaccagcgcgaggcccccctcaacaacttctctgtggcacagtgc
cagctgatgaagacggagcggccgcggcccaacaccttcatcatccgctgcctgcagtgg
accaccgtcatcgagcgcaccttccacgtggagacgcctgaggagcgggaggagtggaca
actgccatccagacggtggccgatggacttaagaagcaagaagaggagatgatggacttc
cggtcgggctcacccagtgacaactcgggggctgaagagatggaggtgtccctggccaag
cccaggcaccgtgtgaccatgaatgagtttgagtacctgaagctgctgggcaagggcact
tttgggaaggtgatcctggtgaaggagaaggccacgggccgctactatgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggacgaggtggcccacacgctcacggagaaccga
gtcctacagaactccaggcaccccttcctcacggccctgaagtattccttccagacccac
gaccgcctctgctttgtcatggagtacgccaacggtggcgagctcttcttccacctgtcc
cgcgagcgtgtgttctccgaggaccgggcccgcttctatggcgccgagatcgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggatgggcacatcaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggtgccaccatgaagaccttctgcggcactcctgagtacctggcccctgaggtg
ctggaggacaatgactacggccgcgcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgtggccgcctgcccttctacaaccaggaccacgagaagctctttgagctc
atcctcatggaggagatccgcttcccgcgcacgctcggccctgaggccaagtctttgctc
tcagggctgctcaagaaggaccccaagcagaggcttggtgggggctctgaggacgccaag
gagatcatgcaacaccgcttctttgctggcatcgcgtggcagcacgtgtacgagaagaag
ctcagcccacccttcaagccccaggtcacatcggagactgacaccaggtattttgacgag
gagttcacagcccagatgatcaccatcacaccacctgaccaagacgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040766
Entry
101040766         CDS       T04350                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040766 (AKT2)
   04012 ErbB signaling pathway
    101040766 (AKT2)
   04014 Ras signaling pathway
    101040766 (AKT2)
   04015 Rap1 signaling pathway
    101040766 (AKT2)
   04370 VEGF signaling pathway
    101040766 (AKT2)
   04371 Apelin signaling pathway
    101040766 (AKT2)
   04630 JAK-STAT signaling pathway
    101040766 (AKT2)
   04668 TNF signaling pathway
    101040766 (AKT2)
   04066 HIF-1 signaling pathway
    101040766 (AKT2)
   04068 FoxO signaling pathway
    101040766 (AKT2)
   04072 Phospholipase D signaling pathway
    101040766 (AKT2)
   04071 Sphingolipid signaling pathway
    101040766 (AKT2)
   04024 cAMP signaling pathway
    101040766 (AKT2)
   04022 cGMP-PKG signaling pathway
    101040766 (AKT2)
   04151 PI3K-Akt signaling pathway
    101040766 (AKT2)
   04152 AMPK signaling pathway
    101040766 (AKT2)
   04150 mTOR signaling pathway
    101040766 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101040766 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    101040766 (AKT2)
   04218 Cellular senescence
    101040766 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101040766 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101040766 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101040766 (AKT2)
   04613 Neutrophil extracellular trap formation
    101040766 (AKT2)
   04620 Toll-like receptor signaling pathway
    101040766 (AKT2)
   04625 C-type lectin receptor signaling pathway
    101040766 (AKT2)
   04660 T cell receptor signaling pathway
    101040766 (AKT2)
   04662 B cell receptor signaling pathway
    101040766 (AKT2)
   04664 Fc epsilon RI signaling pathway
    101040766 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    101040766 (AKT2)
   04062 Chemokine signaling pathway
    101040766 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101040766 (AKT2)
   04922 Glucagon signaling pathway
    101040766 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    101040766 (AKT2)
   04920 Adipocytokine signaling pathway
    101040766 (AKT2)
   04929 GnRH secretion
    101040766 (AKT2)
   04915 Estrogen signaling pathway
    101040766 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    101040766 (AKT2)
   04917 Prolactin signaling pathway
    101040766 (AKT2)
   04926 Relaxin signaling pathway
    101040766 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    101040766 (AKT2)
   04919 Thyroid hormone signaling pathway
    101040766 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101040766 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101040766 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    101040766 (AKT2)
   04728 Dopaminergic synapse
    101040766 (AKT2)
   04722 Neurotrophin signaling pathway
    101040766 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101040766 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    101040766 (AKT2)
   04213 Longevity regulating pathway - multiple species
    101040766 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101040766 (AKT2)
   05205 Proteoglycans in cancer
    101040766 (AKT2)
   05230 Central carbon metabolism in cancer
    101040766 (AKT2)
   05231 Choline metabolism in cancer
    101040766 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101040766 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101040766 (AKT2)
   05212 Pancreatic cancer
    101040766 (AKT2)
   05225 Hepatocellular carcinoma
    101040766 (AKT2)
   05226 Gastric cancer
    101040766 (AKT2)
   05214 Glioma
    101040766 (AKT2)
   05221 Acute myeloid leukemia
    101040766 (AKT2)
   05220 Chronic myeloid leukemia
    101040766 (AKT2)
   05218 Melanoma
    101040766 (AKT2)
   05211 Renal cell carcinoma
    101040766 (AKT2)
   05215 Prostate cancer
    101040766 (AKT2)
   05213 Endometrial cancer
    101040766 (AKT2)
   05224 Breast cancer
    101040766 (AKT2)
   05222 Small cell lung cancer
    101040766 (AKT2)
   05223 Non-small cell lung cancer
    101040766 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101040766 (AKT2)
   05017 Spinocerebellar ataxia
    101040766 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101040766 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101040766 (AKT2)
   04931 Insulin resistance
    101040766 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101040766 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101040766 (AKT2)
   05135 Yersinia infection
    101040766 (AKT2)
   05152 Tuberculosis
    101040766 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101040766 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    101040766 (AKT2)
   05161 Hepatitis B
    101040766 (AKT2)
   05160 Hepatitis C
    101040766 (AKT2)
   05164 Influenza A
    101040766 (AKT2)
   05162 Measles
    101040766 (AKT2)
   05168 Herpes simplex virus 1 infection
    101040766 (AKT2)
   05163 Human cytomegalovirus infection
    101040766 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101040766 (AKT2)
   05169 Epstein-Barr virus infection
    101040766 (AKT2)
   05165 Human papillomavirus infection
    101040766 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101040766 (AKT2)
   05142 Chagas disease
    101040766 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101040766 (AKT2)
   01524 Platinum drug resistance
    101040766 (AKT2)
   01522 Endocrine resistance
    101040766 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101040766 (AKT2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101040766 (AKT2)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101040766 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 101040766
NCBI-ProteinID: XP_003943209
UniProt: A0A2K6V3M0
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRALGEDPM
DYKCGSPSDSSVAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAQEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagtgatggctccttcattgggtacaaggag
aggcccgaggcccctgatcagaccctgccccccttaaacaacttctctgtagcagaatgc
cagctgatgaagactgagaggccgaggcccaacaccttcgtcatacgctgcctgcagtgg
accacagtcattgagaggaccttccatgtggattctccagatgagagggaggagtggatg
cgggccatccagatggtcgccaacagcctcaagcagcgggccctgggcgaggaccccatg
gactacaagtgtggctcccccagtgactcctctgtggccgaggagatggaagtggcggtc
agcaaggcacgggccaaagtgaccatgaatgacttcgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacggtcaccgag
agccgggtcctccagaacaccagacacccgttccttactgcgctgaagtacgctttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaatggtggcgagctgttcttccac
ctgtcccgggaacgtgtcttcacagaggagcgggcccggttttatggtgcagagatcgtc
tcggctcttgagtacttgcactctcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgactttggcctctgcaaagaaggc
atcagcgacggggccaccatgaaaactttctgtgggactccggagtacctggcgcctgag
gtgctggaggacaacgactatggccgggcagtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgtggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccctgaggccaagtccctg
cttgccgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc
caggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaaacctcaggtcacgtctgaggtcgacacacggtacttcgat
gatgaattcaccgcccagtccatcacaatcacaccccctgaccgctatgacagcctgggc
tccctggagctggaccagcggacccacttcccccagttctcttactcggccagcatccgg
gagtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101045714
Entry
101045714         CDS       T04350                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04022  cGMP-PKG signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04380  Osteoclast differentiation
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04613  Neutrophil extracellular trap formation
sbq04620  Toll-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04666  Fc gamma R-mediated phagocytosis
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04728  Dopaminergic synapse
sbq04910  Insulin signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04922  Glucagon signaling pathway
sbq04923  Regulation of lipolysis in adipocytes
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04973  Carbohydrate digestion and absorption
sbq05010  Alzheimer disease
sbq05017  Spinocerebellar ataxia
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101045714 (AKT3)
   04012 ErbB signaling pathway
    101045714 (AKT3)
   04014 Ras signaling pathway
    101045714 (AKT3)
   04015 Rap1 signaling pathway
    101045714 (AKT3)
   04370 VEGF signaling pathway
    101045714 (AKT3)
   04371 Apelin signaling pathway
    101045714 (AKT3)
   04630 JAK-STAT signaling pathway
    101045714 (AKT3)
   04668 TNF signaling pathway
    101045714 (AKT3)
   04066 HIF-1 signaling pathway
    101045714 (AKT3)
   04068 FoxO signaling pathway
    101045714 (AKT3)
   04072 Phospholipase D signaling pathway
    101045714 (AKT3)
   04071 Sphingolipid signaling pathway
    101045714 (AKT3)
   04024 cAMP signaling pathway
    101045714 (AKT3)
   04022 cGMP-PKG signaling pathway
    101045714 (AKT3)
   04151 PI3K-Akt signaling pathway
    101045714 (AKT3)
   04152 AMPK signaling pathway
    101045714 (AKT3)
   04150 mTOR signaling pathway
    101045714 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101045714 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    101045714 (AKT3)
   04218 Cellular senescence
    101045714 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101045714 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101045714 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101045714 (AKT3)
   04613 Neutrophil extracellular trap formation
    101045714 (AKT3)
   04620 Toll-like receptor signaling pathway
    101045714 (AKT3)
   04625 C-type lectin receptor signaling pathway
    101045714 (AKT3)
   04660 T cell receptor signaling pathway
    101045714 (AKT3)
   04662 B cell receptor signaling pathway
    101045714 (AKT3)
   04664 Fc epsilon RI signaling pathway
    101045714 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    101045714 (AKT3)
   04062 Chemokine signaling pathway
    101045714 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101045714 (AKT3)
   04922 Glucagon signaling pathway
    101045714 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    101045714 (AKT3)
   04920 Adipocytokine signaling pathway
    101045714 (AKT3)
   04929 GnRH secretion
    101045714 (AKT3)
   04915 Estrogen signaling pathway
    101045714 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    101045714 (AKT3)
   04917 Prolactin signaling pathway
    101045714 (AKT3)
   04926 Relaxin signaling pathway
    101045714 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    101045714 (AKT3)
   04919 Thyroid hormone signaling pathway
    101045714 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101045714 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101045714 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    101045714 (AKT3)
   04728 Dopaminergic synapse
    101045714 (AKT3)
   04722 Neurotrophin signaling pathway
    101045714 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101045714 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    101045714 (AKT3)
   04213 Longevity regulating pathway - multiple species
    101045714 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101045714 (AKT3)
   05205 Proteoglycans in cancer
    101045714 (AKT3)
   05230 Central carbon metabolism in cancer
    101045714 (AKT3)
   05231 Choline metabolism in cancer
    101045714 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101045714 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101045714 (AKT3)
   05212 Pancreatic cancer
    101045714 (AKT3)
   05225 Hepatocellular carcinoma
    101045714 (AKT3)
   05226 Gastric cancer
    101045714 (AKT3)
   05214 Glioma
    101045714 (AKT3)
   05221 Acute myeloid leukemia
    101045714 (AKT3)
   05220 Chronic myeloid leukemia
    101045714 (AKT3)
   05218 Melanoma
    101045714 (AKT3)
   05211 Renal cell carcinoma
    101045714 (AKT3)
   05215 Prostate cancer
    101045714 (AKT3)
   05213 Endometrial cancer
    101045714 (AKT3)
   05224 Breast cancer
    101045714 (AKT3)
   05222 Small cell lung cancer
    101045714 (AKT3)
   05223 Non-small cell lung cancer
    101045714 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101045714 (AKT3)
   05017 Spinocerebellar ataxia
    101045714 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101045714 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101045714 (AKT3)
   04931 Insulin resistance
    101045714 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101045714 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101045714 (AKT3)
   05135 Yersinia infection
    101045714 (AKT3)
   05152 Tuberculosis
    101045714 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101045714 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    101045714 (AKT3)
   05161 Hepatitis B
    101045714 (AKT3)
   05160 Hepatitis C
    101045714 (AKT3)
   05164 Influenza A
    101045714 (AKT3)
   05162 Measles
    101045714 (AKT3)
   05168 Herpes simplex virus 1 infection
    101045714 (AKT3)
   05163 Human cytomegalovirus infection
    101045714 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101045714 (AKT3)
   05169 Epstein-Barr virus infection
    101045714 (AKT3)
   05165 Human papillomavirus infection
    101045714 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101045714 (AKT3)
   05142 Chagas disease
    101045714 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101045714 (AKT3)
   01524 Platinum drug resistance
    101045714 (AKT3)
   01522 Endocrine resistance
    101045714 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101045714 (AKT3)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101045714 (AKT3)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101045714 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 101045714
NCBI-ProteinID: XP_003935379
UniProt: A0A2K6U3Q1
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccgtatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggacc
actgttatagaaagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggccgtagcagacagactacagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataacataggggaagaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagtcattttggttcgagagaaggcaagtggaaaatactatgctatgaagatcctgaag
aaagaagtcattattgcaaaggatgaagtggcacacacgctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtttaccgtgatctcaagttggagaatctaatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtgggacaccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctcggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccacgagaaacttttcgaactcatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcgaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtctatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaggaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcaattttcctactctgcaagtggacgagaataa

DBGET integrated database retrieval system