KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035001
Entry
101035001         CDS       T04350                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4 isoform X1
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04064  NF-kappa B signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq04630  JAK-STAT signaling pathway
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101035001 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035001 (PIAS4)
   04064 NF-kappa B signaling pathway
    101035001 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101035001 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101035001 (PIAS4)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101035001 (PIAS4)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101035001 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP
Other DBs
NCBI-GeneID: 101035001
NCBI-ProteinID: XP_010347765
UniProt: A0A2K6TXW5
LinkDB
Position
Unknown
AA seq 499 aa
MVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYKKNS
ESVPQPHRPLDPLTMHSTYDRASAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEV
RLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQV
VLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYL
SSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCKALVKEKLRLDP
DSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKP
APYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGTILVLGPSDANG
LLPAPSVNGSGALGSTGGSGSAGSVENGKPGADVVDLTLDSSSSSEDEEEEEEEDEDEDE
EGPRPKRRCPFQKGLVPAC
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggtgatgagttttcgagtctccgaccttcagatgctcctgggtttcgtgggccggagt
aagagcggactgaagcacgagctcgtcaccagagccctccagctggtgcagtttgactgt
agcccagagctgttcaagaagatcaaggagctgtacgagacccgctacaagaagaactcg
gagtctgtcccgcagccgcaccggcccttggaccccctgaccatgcactccacctatgac
cgggccagcgccgtgcccaggactccgctggcaggccccaatattgactaccccgtgctc
tacgggaagtacttaaacggactgggacggttgcccgccaagaccctcaagccagaagtc
cgcctggtgaagctgcccttctttaatatgctggacgagctgctgaagcccactgagtta
gtcccacagaacaacgagaagcttcaggagagcccgtgcatcttcgcgttgacaccaaga
caggtggagctgatccggaactccagagaactgcagcctggagtcaaagctgtgcaggtc
gtcctgagaatctgctactcagacaccagctgccctcaggaggaccagtacccacccaac
attgccgtaaaggtcaaccacagctactgctcggtcccgggttactacccatccaataag
cccggggtggagcccaagaggccgtgccgccccatcaacctcacccacctcatgtacctg
tcctcggccaccaaccgcatcaccgtcacctgggggaactatggcaagagctactcggtg
gccctgtacctggtgcggcagctgacctcgtcggagctgctgcagaggctgaagaccatt
ggggtgaagcacccggagctgtgcaaggcgctggtcaaggagaagcttcgcctggatcct
gacagcgagattgccaccactggggtgcgggtgtctctcatctgcccgctggtgaagatg
cggctctctgtgccctgccgggcagagacctgcgcacacctgcagtgcttcgacgccgtc
ttctacctgcagatgaatgagaagaagcccacctggatgtgcccggtgtgtgacaagcca
gccccctacgaccagctcatcatcgatggcctcctctcgaagatcctgagcgagtgtgag
gacgccgacgagatcgaatacctggtagacggctcatggtgcccgatccgcgctgagaag
gagcgcagctgcagcccgcagggcaccatcctcgtcctgggcccctcagatgccaatggg
ctcctgcccgcccccagcgtcaacgggagtggtgccctgggcagcacgggtggcagcggc
tcggcgggcagtgtggagaatgggaagccaggcgcagacgtggtggacctcacgctggac
agctcatcgtcctcagaggatgaggaggaggaggaggaggaggatgaggacgaggatgag
gagggcccccggcctaagcgccgctgccccttccagaagggcctggtgccagcctgctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035858
Entry
101035858         CDS       T04350                                 

Gene name
PIAS2
Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04120  Ubiquitin mediated proteolysis
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101035858 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035858 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101035858 (PIAS2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     101035858 (PIAS2)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101035858 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 101035858
NCBI-ProteinID: XP_010333699
LinkDB
Position
Unknown
AA seq 613 aa
MVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTL
EGLSDLSTIKSSVFSLDGSSSPVEPELAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPT
FEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVR
EICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPK
NGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLK
MKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFD
AALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRP
KKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRK
CIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLP
GLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVIT
SSGSNIPDIISLD
NT seq 1842 nt   +upstreamnt  +downstreamnt
atggtttctagttttagggtttctgaactacaagtattactaggctttgctggacggaat
aaaagtggacgcaagcatgacctcctgatgagggcgttgcatttattgaagagcggctgc
agccctgcggttcagattaaaatccgagaattgtatagacgccgatatccacgaactctt
gaaggactttctgatttatccacaatcaaatcatcggttttcagtttggatggtagctca
tcacctgtagaacctgaattggccgtggctggaatccactcgttgccttccacttcagtt
acacctcactcaccatcctctcctgttggttctgtgctgcttcaagatactaagcccaca
tttgagatgcagcagccatctcccccaattcctcctgtccatcctgatgtgcagttaaaa
aatctgcccttttatgatgtccttgatgttctcatcaagcccacgagtttagttcaaagc
agtattcagcgatttcaagagaagttttttattttcgctttgacacctcaacaagttaga
gagatatgcatatccagggattttttgccaggtggtaggagagattatacagtccaagtt
cagttgagactttgcctggcagaaacaagttgccctcaagaagataactatccaaatagt
ctgtgtataaaagtaaatgggaagctatttcctttgcctggctatgcaccaccacctaaa
aatgggattgaacagaagcgccctggacgccccttgaatattacatctttagttaggtta
tcttcagctgtgccaaaccaaatttccatttcttgggcatcagaaattgggaagaattac
tccatgtctgtatatcttgtacgacagcttacgtcagccatgttattacagagattaaaa
atgaaaggtattagaaatcctgatcattccagagcactaataaaggaaaaacttactgcg
gatcctgatagtgaaatcgctacaactagccttcgggtatccttgatgtgccccttagga
aaaatgaggctgacaatcccatgccgtgcagtgacttgtacacatctgcagtgttttgat
gctgccctttatctacaaatgaatgagaaaaagcccacctggatttgtcctgtatgtgac
aaaaaagctgcctatgaaagtctaatattagatgggctttttatggaaattctcaatgac
tgttctgatgtggatgagatcaaattccaagaagatggttcttggtgtccaatgaggccg
aagaaagaagctatgaaagtatccagccaaccatgtacaaaaatagaaagttcaagtgtc
ctcagtaaaccttgttcagtgactgtagccagtgaggcaagcaagaagaaagtagatgtt
attgatctgacaatagaaagctcctccgatgaagaggaagaccctcctgccaaaaggaaa
tgcatctttatgtcagaaacacaaagcagcccaaccaaaggggttctcatgtatcagcca
tcttctgtaagggtgcccagtgtgacttcggttgatcctgctgctattccgccttcatta
acagactactcagtaccattccaccacacgccaatatcaagcatgtcatcagatttgcca
ggtttggattttctttcccttattccagttgatccccagcagtactgtcctcctatgttt
ttggatagtctcacctcacccttaacagcaagcagtacgtctgtcaccaccaccagctcc
catgaaagcagtactcatgttagttcatccagcagcaggagtgagacaggggtcataacc
agcagtggaagtaacattcctgacatcatctcattggactaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036739
Entry
101036739         CDS       T04350                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1 isoform X1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04120  Ubiquitin mediated proteolysis
sbq04630  JAK-STAT signaling pathway
sbq05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101036739 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101036739 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    101036739 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101036739 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101036739 (PIAS1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     101036739 (PIAS1)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101036739 (PIAS1)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    101036739 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 101036739
NCBI-ProteinID: XP_003929741
UniProt: A0A2K6U6T8
LinkDB
Position
Unknown
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLNSTLEHQVTSHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRNSTDTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaacttcaa
gtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgtagtcctgctgtacaaatgaaaattaaggaactc
tataggcggcggttcccgcagaaaatcatgacgcctgcagacttgtccatccccaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacagctcacttacgat
ggtcaccctgcatcatcaccattactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgccttgacaccacagcaagtgcagcaa
atcagcagttccatggatatttctgggaccaaatgtgacttcacagtacaggtccagtta
aggttttgtttatcagaaactagttgtccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttaccttccacctacaaaaaatggc
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgactgtccaca
acagtaccaaacaccattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttctgcttcagagattacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttgactgcggatcca
gatagtgaaatagctacaaccagcctaagggtttctctgctatgtccacttggtaaaatg
cggctgacaattccgtgtcgggcccttacatgctctcacctacaatgttttgacgcaact
ctttacattcagatgaacgagaaaaaaccaacctgggtctgtcctgtctgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gactgcgatgaaatacaatttaaggaggatggctcttgggcaccaatgagatcgaaaaag
gaagtacaggaagtttctgcctcatacaatggagttgatggatgcttgaactccacattg
gagcatcaggtaacttctcaccaccagtcctcaaataaaaacaagaaagtagaagtgatt
gacctaaccatagacagttcatctgatgaagaggaagaagagccatctgccaagaggact
tgtccttccctgtctcccacatcaccactaaataataaaggcattttaagtcttccacat
caagcatctccagtatcccgcaccccaagccttcctgctgtagacacaagctacattaat
acctccctgatccaagactataggcatcctttccacatgacacccatgccttatgactta
caagggttagattttttccctttcttatcaggagacaatcagcattacaacacctccttg
cttgccgctgcagcggcagcggtttcagatgatcaagacctcctgcattcgtctcggttt
tttccgtatacctcctcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggaagcagtagtggcagtaacagcagcctggtttcctccaacagc
ctaagggagagccatagccacactgtcacaaacaggaacagcacggacacagcatccatt
tttggcatcataccagacattatttcattggactaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041839
Entry
101041839         CDS       T04350                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04120  Ubiquitin mediated proteolysis
sbq04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101041839 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101041839 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sbq04121]
    101041839 (PIAS3)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     101041839 (PIAS3)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   101041839 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 101041839
NCBI-ProteinID: XP_010330604
UniProt: A0A2K6T8G6
LinkDB
Position
Unknown
AA seq 653 aa
MAWQDRPVRGRILRLLCSSPQHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLNS
SCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLL
GPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQ
QVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLP
PTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQ
KLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRAITCAHLQ
SFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCP
MKPKKEASEVCPPPGYGLDGLQYSAVQEGHPSENKKKVEVIDLTTESSSDEEDLPPPKRH
CPVEDLPPPKRHCPVASAAVPALPGSKGVLTPGHQPSSVLRSPAMGTLGGDFLSSLPLHE
YPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPAHFLGPLAP
TLGSSHRSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1962 nt   +upstreamnt  +downstreamnt
atggcttggcaggacaggcctgtgcgaggtaggattctgaggcttctgtgttcttctcca
cagcacatggtgatgagtttccgggtgtctgagctccaggtgcttcttggctttgctggc
cggaacaagagtggacggaagcacgagctcctggccaaggccctgcacctcctgaattcc
agctgtgcccctagcgtccagatgaagatcaaagagctctaccgacgacgctttccccgg
aagaccctggggccctctgatctctccctgctctctttgccccctggcacctctcccgta
ggctcccctggccctctagctcccattcccccaaccctgttggcccctggcaccctgctg
ggccccaagcgtgaggtggacatgcacccccctctgccccagcctgtgcaccccgacgtc
accatgaaaccactgcccttctatgaggtctacggggagctcatccggcccaccactctt
gcatccacttccagccagcggtttgaggaagcacacttcacctttgccctcacaccccag
caagtgcagcagattctcacctccagagaggttctgccaggagccaaatgtgattatacc
atacaggtgcagctaaggttctgtctctgtgagaccagctgcccccaggaagattatttt
cccccaaacctctttgtcaaggtcaacgggaaactgtgccccctgccgggttaccttccc
ccaaccaagaatggggctgagcccaagaggcccagccgccccatcaacatcacacccctg
gctcgactctcagccactgttcctaacactattgtggtcaattggtcatctgagttcgga
cggaattactccttgtctgtgtacctggtgaggcagctgactgcagggacccttctacag
aaactcagagcaaagggtatccggaaccccgatcactcgagggcactgatcaaggagaaa
ttgactgctgaccctgacagtgaggtggccactacgagtctccgggtgtcactcatgtgc
ccgctagggaagatgcgcctgactgtcccttgccgcgccatcacctgtgcccacctgcag
agtttcgacgctgccctttatctacagatgaacgaaaagaagccaacatggacgtgtcct
gtgtgcgacaagaaggcgccctatgaatctcttatcattgatggtttatttatggagatt
cttagttcctgttcagattgtgatgagatccagttcatggaagatggatcctggtgccca
atgaaacccaagaaggaggcatctgaggtttgccccccgccagggtatgggctggatggc
ctccagtacagcgcagtccaggagggccatccgtcagagaataagaagaaggtcgaagta
attgacttgacaacagaaagctcatcagatgaggaggatctgcccccacccaagaggcac
tgtcccgtcgaggatctgcccccacccaagaggcactgtcccgtcgcctccgctgccgtc
cccgccctacctggaagcaaaggagtcctgacgcctggccaccagccatcctcggtgctg
aggagccctgccatgggcacgctgggtggggatttcctgtccagtctcccactccatgag
tacccacctgccttcccactgggagccgacatccaaggtttagatttattttcatttctt
cagacagagagtcagcactacggcccctccgtcatcacgtcactagatgaacaagatgcc
cttggccacttcttccagtaccgagggacccctgctcactttctgggcccactggccccc
acgttggggagctcccatcgcagcgccactccggcgccccctcctggccgtgtcagcagc
attgtggcccctgggggggccttgagggaggggcatggaggacccctgccctcaggtccc
tctttgactggctgtcggtcagacatcatttccctggactga

DBGET integrated database retrieval system