KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035044
Entry
101035044         CDS       T04350                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04151  PI3K-Akt signaling pathway
sbq04217  Necroptosis
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
sbq05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101035044 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    101035044 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035044 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101035044 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101035044 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    101035044 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    101035044 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101035044 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035044 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101035044 (IFNAR1)
   05160 Hepatitis C
    101035044 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    101035044 (IFNAR1)
   05164 Influenza A
    101035044 (IFNAR1)
   05162 Measles
    101035044 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    101035044 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101035044 (IFNAR1)
   05169 Epstein-Barr virus infection
    101035044 (IFNAR1)
   05165 Human papillomavirus infection
    101035044 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035044 (IFNAR1)
Cytokine receptors [BR:sbq04050]
 Interleukin receptor families
  IFN receptor family
   101035044 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101035044
NCBI-ProteinID: XP_003927702
UniProt: A0A2K6SNA4
LinkDB
Position
Unknown
AA seq 552 aa
MVALLGATTLVLVAVAPWVLPAAAGGKNLKSSQKVEVDIIDDNFILKWDRSDESLRSVTF
SFDYQKSGTDNWIKLPGCQNITSTKCNFSSVKLNVYEEMKLRIRAEKENTSSWYEVDPFT
PYNKAQIGPPEVHLEAEDKAIMIKISPPGTKNSVMWALDGSSFRYSLVIWKNSSSGEEEI
ENIYSIRKIYKLSPETTYCLKVKAALPVARKVGIYGPVYCIKTTVENELPPPENIEVSVQ
NQSCVLKWDYAYANVTFQVQWLHAFLKRNSMNHSYKWKQMPDCENVKTTQCVFPQNVFPK
GIYFLRVQASDGNNTSFWSEEIKFDTEIQAFLPPPVLKVKPIGDSLHIHIDAPKESGSKP
VNEDYPFTYEIIFWENTSNAERKFFKKETDFIVPNLKPLTVYCVKARAHTMDEKWNKSSA
FSDVVFVETKPGNASNIWLIAGICTAIIAIVAVIYVVKVLLRCINYVFFPSPKPSSNIDE
YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHEKYSSQNCQDSGNYSN
EDESESKTSEEL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggtcgccctcctgggggcgacgaccctggtgctcgtcgccgtggcgccatgggtgttg
cccgcagccgcaggtgggaaaaatctaaaatcttctcaaaaagtagaagtcgacatcata
gatgacaactttatcctgaagtgggacaggagtgatgagtctcttaggagtgtgactttt
tcattcgattatcaaaaatctgggacagataattggataaaattgcctgggtgtcagaat
attactagtaccaaatgcaacttttcttcagtcaagttgaatgtttatgaagaaatgaaa
ttgcgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgacccatttaca
ccatataacaaagctcaaattggtcctccagaagtacatttggaagctgaagataaggca
ataatgataaagatctctcctcctggaacaaaaaatagtgtcatgtgggctttggatggt
tcaagctttagatacagcttagttatctggaaaaactcttcaagtggagaagaagagatt
gaaaatatttattccatacgtaaaatttataaactttcaccagagactacctattgttta
aaagttaaagcagcactacctgtggcaaggaaagtcggtatctatggtccagtatattgt
ataaagaccacagttgaaaacgaactacctccaccagaaaatatagaagtcagtgttcag
aatcagagctgtgttctgaagtgggattacgcatatgcaaacgtgacctttcaagttcag
tggctccacgcctttttaaaaaggaattctatgaaccattcgtataaatggaaacaaatg
cctgactgtgaaaatgtcaaaactacccagtgtgtctttcctcaaaatgttttcccaaaa
ggaatttactttctccgtgtacaagcatctgatggaaataacacatctttttggtctgaa
gagataaagtttgatactgaaatacaagctttcctacctcctccagtccttaaagttaaa
cccattggtgattcattacatatccatattgatgctccaaaagagtcgggaagcaagcct
gtgaacgaggattatccattcacttatgaaattattttttgggaaaacacttcaaatgct
gagagaaaatttttcaagaaagaaacggattttattgttcctaatttgaaaccactgact
gtatattgtgtcaaagccagagcacacaccatggatgaaaagtggaataaaagcagtgct
tttagtgatgttgtgtttgtggaaacaaaaccaggaaatgcatctaatatttggcttata
gctggaatttgtactgcaataattgctatcgtagctgtcatttatgttgtaaaagttctc
ctgagatgcatcaattatgtgttctttccatcacctaaaccttcttccaatatagatgag
tatttctctgaacagccattgaagaatcttctgctttcaacttctgaagaacaaattgaa
aaatgttttataattgaaaatataagcacaattgctacagtagaagaaactaatcaaact
gatgaagatcatgaaaaatacagttcccaaaactgccaggattcaggaaattattctaat
gaagatgaaagtgaaagtaaaacaagtgaagaactgtag

DBGET integrated database retrieval system