KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035231
Entry
101035231         CDS       T04350                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral-signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05164  Influenza A
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101035231 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    101035231 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    101035231 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    101035231 (MAVS)
   05160 Hepatitis C
    101035231 (MAVS)
   05171 Coronavirus disease - COVID-19
    101035231 (MAVS)
   05164 Influenza A
    101035231 (MAVS)
   05162 Measles
    101035231 (MAVS)
   05168 Herpes simplex virus 1 infection
    101035231 (MAVS)
   05169 Epstein-Barr virus infection
    101035231 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 101035231
NCBI-ProteinID: XP_003941135
UniProt: A0A2K6TYZ6
LinkDB
Position
Unknown
AA seq 533 aa
MPFAEDKTYKYICRHFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TLQRRPGWVESFIVALRACELSDLADEVARVYQSYQPRTPEHPPAPLEPPSVSAEVPGPS
TPAAAHSIPYNGYREKEPSYPMPVQESQPPQSLEESSEQAPQTLSPRAIPRRPGGGPVEP
SSDLAALSPLTSSGHQEQDTELGSTHTAAATSSLPPSRGPVSPSVSFQPLVRSTPRASRL
PGPAGSVSTGTFSSSSSPGLASAGAEEGDQPEPIICSSGAEAPANSLPSKVPTTLMPVNT
VPPEVPANPASASTVPSKLPPVSKPPGAVPSNVLTNPAPSKLPINSTHAGMVPSKVPTSM
VLTTGNASTVPTGRSSRAKENPAAPTPAGATGGSSAWLDDSSENGGLGSELSKPGMLVSR
VDSLFSGCSEDLAISASSSLGVGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPA
DLEGGPRPHTNQKFQDKEVPCHWSSLGSPWLQAAVAGVLAAILLAVLYQRRQL
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgccgtttgctgaagacaaaacctataagtatatctgcagacatttcagcaatttttgc
aatgtggatgttgtagagattctgccttacctgccctgcctcacagcaagagaccaggat
cgactgcgggccacttgcacactctcagggaaccgggacaccctctggcatctcttcaat
acccttcagcggcgacctggctgggtggagtccttcattgtggcgctgagggcctgtgag
ctgtctgatctcgcggacgaagtggcccgtgtctaccagagctaccagcctcggaccccg
gaacatcccccagccccactggagccaccgtcagtttctgctgaggtgccaggaccctcc
acgcctgctgcggcccacagcatcccctacaatggctacagagagaaggagccaagctac
cccatgcctgtccaggagtcccagccgccacagtccctggaagagagttcagagcaagcc
ccgcagacgctcagccccagagccatcccaaggaggccgggtggtggtcctgtggagccc
tcctctgacctggcagcccttagtcctctgacctccagtgggcatcaggagcaggacaca
gaactgggcagtacccacacagcagctgcaacctccagcctcccaccatcccgtgggcct
gtgtctccatctgtctccttccagcctctggtccgatccacccccagggcaagccgcttg
ccaggacctgcagggtcagtttctactggtaccttctcctcttcctcatcccctggcttg
gcctctgcaggggctgaagagggtgaccagcccgagcctatcatctgctccagcggggca
gaggcacctgccaactctctgccctccaaagtgcctaccaccttgatgcctgtgaacaca
gtacccccggaagtgcctgccaacccagcatctgccagcacagtgccctccaagttgcca
cctgtttcgaagccccctggtgcagtgccttctaatgtgctcaccaatccagcaccatcc
aaattgcccatcaactcaactcatgctggcatggtgccatccaaagtgcccactagcatg
gtgctcaccacagggaatgccagcacagttcccaccggcaggagcagcagagctaaggag
aacccagcagctccaacacccgcaggtgccactggaggcagctcagcctggctagacgat
agctctgagaatgggggccttgggtcggagttgagcaagcctggcatgctggtatcccgg
gtagacagcctattctcgggctgctctgaggatcttgccatcagtgccagcagctccttg
ggcgtggggccctgccatggcccagaggagaatgagtacaagtccgagggcacctttggg
atccacgtggctgagaaccccagcatccagctcctggagggcaaccctgggccacctgcg
gacctggagggtggccccaggccacacaccaaccagaagttccaggacaaggaggtgcca
tgccactggtcctcgctcgggtctccgtggctccaggcagctgtggcaggggtgctggca
gccatactcctggcagtgctgtaccagcggcgccagctctag

DBGET integrated database retrieval system