KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035406
Entry
101035406         CDS       T04350                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01523  Antifolate resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04024  cAMP signaling pathway
sbq04062  Chemokine signaling pathway
sbq04064  NF-kappa B signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04137  Mitophagy - animal
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04218  Cellular senescence
sbq04380  Osteoclast differentiation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04623  Cytosolic DNA-sensing pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04917  Prolactin signaling pathway
sbq04920  Adipocytokine signaling pathway
sbq04926  Relaxin signaling pathway
sbq04931  Insulin resistance
sbq04932  Non-alcoholic fatty liver disease
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05030  Cocaine addiction
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05134  Legionellosis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05146  Amoebiasis
sbq05152  Tuberculosis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05212  Pancreatic cancer
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05222  Small cell lung cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05321  Inflammatory bowel disease
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101035406 (RELA)
   04014 Ras signaling pathway
    101035406 (RELA)
   04064 NF-kappa B signaling pathway
    101035406 (RELA)
   04668 TNF signaling pathway
    101035406 (RELA)
   04066 HIF-1 signaling pathway
    101035406 (RELA)
   04071 Sphingolipid signaling pathway
    101035406 (RELA)
   04024 cAMP signaling pathway
    101035406 (RELA)
   04151 PI3K-Akt signaling pathway
    101035406 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101035406 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    101035406 (RELA)
   04218 Cellular senescence
    101035406 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101035406 (RELA)
   04621 NOD-like receptor signaling pathway
    101035406 (RELA)
   04622 RIG-I-like receptor signaling pathway
    101035406 (RELA)
   04623 Cytosolic DNA-sensing pathway
    101035406 (RELA)
   04625 C-type lectin receptor signaling pathway
    101035406 (RELA)
   04660 T cell receptor signaling pathway
    101035406 (RELA)
   04658 Th1 and Th2 cell differentiation
    101035406 (RELA)
   04659 Th17 cell differentiation
    101035406 (RELA)
   04657 IL-17 signaling pathway
    101035406 (RELA)
   04662 B cell receptor signaling pathway
    101035406 (RELA)
   04062 Chemokine signaling pathway
    101035406 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101035406 (RELA)
   04917 Prolactin signaling pathway
    101035406 (RELA)
   04926 Relaxin signaling pathway
    101035406 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101035406 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101035406 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    101035406 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035406 (RELA)
   05202 Transcriptional misregulation in cancer
    101035406 (RELA)
   05203 Viral carcinogenesis
    101035406 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101035406 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101035406 (RELA)
   05221 Acute myeloid leukemia
    101035406 (RELA)
   05220 Chronic myeloid leukemia
    101035406 (RELA)
   05215 Prostate cancer
    101035406 (RELA)
   05222 Small cell lung cancer
    101035406 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101035406 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101035406 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    101035406 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    101035406 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101035406 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101035406 (RELA)
   04931 Insulin resistance
    101035406 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101035406 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101035406 (RELA)
   05135 Yersinia infection
    101035406 (RELA)
   05133 Pertussis
    101035406 (RELA)
   05134 Legionellosis
    101035406 (RELA)
   05152 Tuberculosis
    101035406 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101035406 (RELA)
   05170 Human immunodeficiency virus 1 infection
    101035406 (RELA)
   05162 Measles
    101035406 (RELA)
   05164 Influenza A
    101035406 (RELA)
   05161 Hepatitis B
    101035406 (RELA)
   05160 Hepatitis C
    101035406 (RELA)
   05168 Herpes simplex virus 1 infection
    101035406 (RELA)
   05163 Human cytomegalovirus infection
    101035406 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101035406 (RELA)
   05169 Epstein-Barr virus infection
    101035406 (RELA)
   05165 Human papillomavirus infection
    101035406 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101035406 (RELA)
   05145 Toxoplasmosis
    101035406 (RELA)
   05140 Leishmaniasis
    101035406 (RELA)
   05142 Chagas disease
    101035406 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101035406 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101035406 (RELA)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101035406 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101035406
NCBI-ProteinID: XP_010346627
UniProt: A0A2K6V452
LinkDB
Position
Unknown
AA seq 520 aa
MRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELV
GKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAINQRIQTNNNPFQVPIEEQRGD
YDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDE
IFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPGLQAPVRVSMQ
LRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRI
AVPSRSSASIPKPAPQPYPFTSSLSTINYDEFPTMVFPSEQISQASALAPAPPQVLPQAP
APAPAPPMVSALAQAPAPVPVLAPGPPQAMAPPAPKPTQAGEGTLSEALLQLQFDDEDLG
ALLGNSTDPAVFTDLASVDNSEFQQLMNQSLPVAPHTTEPMLMEYPEAITRLVTGAQRPP
DPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcgcttccgctacaaatgcgaggggcgctccgcaggcagcatcccaggcgagaggagc
acagataccaccaagacgcaccccaccatcaagatcaatggctacacagggccagggacg
gtgcgcatctccctggtcaccaaggaccctcctcaccggcctcacccccatgagcttgta
ggaaaagactgccgggatggcttctatgaggctgagctctgcccggaccgctgcatccac
agtttccagaacctgggaatccagtgtgtgaagaagcgagatctggagcaggctatcaat
cagcgcatccagaccaacaacaatcccttccaagttcccatagaagagcagcgtggggac
tatgacctgaacgctgtgcggctctgcttccaggtgacagtgcgggatccatcaggcagg
cccctccgcctgccgcctgtcctctctcatcccatctttgataaccgtgctcctaacact
gcagagctcaagatctgccgagtgaaccgcaactctggcagctgcctcggtggggatgag
atcttcctgttgtgtgacaaggtgcagaaagaggacattgaggtgtatttcacggggcca
ggctgggaggcccgaggctcgttttcgcaagctgacgtgcaccgccaagtggccattgtg
ttccggacccctccctacgcagaccccggcctgcaggctcccgtgcgtgtgtccatgcag
ctgcggcggccttccgaccgggagctcagcgagcccatggaattccagtacctgccagat
acagatgatcgccaccggattgaggagaaacgcaaaaggacatatgagaccttcaagagt
atcatgaagaagagtcctttcagcggacccaccgatccccggcctccaccccggcgcatt
gctgtgccttcgcgcagctcggcttccatccccaagccagcccctcagccctatcccttt
acgtcatccctgagcaccatcaactatgatgagtttcccaccatggtgtttccttctgag
cagataagccaggcctcagccttggccccagcccctccccaagtcctgcctcaggctcca
gcccctgcccctgccccacccatggtatcagctctggcccaggccccagccccggtccca
gtcctggccccaggccctcctcaggctatggccccacctgcccccaagcccacgcaggct
ggggagggaacactgtcagaggccctgctgcagctgcagtttgatgatgaagacctgggg
gccttgcttggcaacagcacagacccagctgtgttcacagacctggcatccgtcgacaac
tcggagtttcagcagctgatgaaccagagcctacctgtggccccacacacaactgagccc
atgctgatggagtaccctgaggctataactcgcctagtgacaggggcccagaggccccct
gacccagctcctgctccactgggggccccagggctccctaacggcctcctttcaggggat
gaagacttctcctccattgcggacatggacttctcagccctgctgagtcagatcagctcc
taa

DBGET integrated database retrieval system