KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035635
Entry
101035635         CDS       T04350                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04010  MAPK signaling pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04115  p53 signaling pathway
sbq04210  Apoptosis
sbq04217  Necroptosis
sbq04650  Natural killer cell mediated cytotoxicity
sbq04668  TNF signaling pathway
sbq04932  Non-alcoholic fatty liver disease
sbq04940  Type I diabetes mellitus
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05320  Autoimmune thyroid disease
sbq05330  Allograft rejection
sbq05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101035635 (FAS)
   04668 TNF signaling pathway
    101035635 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035635 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101035635 (FAS)
   04217 Necroptosis
    101035635 (FAS)
   04115 p53 signaling pathway
    101035635 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101035635 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035635 (FAS)
   05205 Proteoglycans in cancer
    101035635 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101035635 (FAS)
   05330 Allograft rejection
    101035635 (FAS)
   05332 Graft-versus-host disease
    101035635 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101035635 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101035635 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101035635 (FAS)
   04932 Non-alcoholic fatty liver disease
    101035635 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101035635 (FAS)
   05161 Hepatitis B
    101035635 (FAS)
   05160 Hepatitis C
    101035635 (FAS)
   05164 Influenza A
    101035635 (FAS)
   05162 Measles
    101035635 (FAS)
   05168 Herpes simplex virus 1 infection
    101035635 (FAS)
   05163 Human cytomegalovirus infection
    101035635 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101035635 (FAS)
   05169 Epstein-Barr virus infection
    101035635 (FAS)
   05165 Human papillomavirus infection
    101035635 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101035635 (FAS)
   05143 African trypanosomiasis
    101035635 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101035635 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sbq04050]
    101035635 (FAS)
   04090 CD molecules [BR:sbq04090]
    101035635 (FAS)
Cytokine receptors [BR:sbq04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101035635 (FAS)
CD molecules [BR:sbq04090]
 Proteins
  101035635 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 Stn1_C
Other DBs
NCBI-GeneID: 101035635
NCBI-ProteinID: XP_003922473
UniProt: A0A2K6US46
LinkDB
Position
Unknown
AA seq 327 aa
MLGLWTLLTLVLKLFGLLSKSVNAQVTDVNPKGLELRKTVTTIENQNLDDQYYVPQFCRK
PCGPGEKKARDCTMDGDEPDCVPCQEGREYTDKSHFSSKCRRCRLCDEGHGLEVEINCTR
TQNTKCRCKPNFFCDSAVCEHCDPCTICEHGIIKECTLTSNAKCKEEGFKYGLLWLCLLL
LLIPPIAWEVRRRIKHRRENQGHRESTTLNSETVPMNLSDVDLSKYITVIAEHMTISQVR
DFVRKNGVNEAKIDEIKNDNIKDTAEQKVQLLRNWYQLHGKKDAYDTLIKGLKKANLTTL
AEKIQNIIIKDSENSNFRNQNENQSMV
NT seq 984 nt   +upstreamnt  +downstreamnt
atgctgggcctctggaccctcctaactctggttcttaaattatttggattattgtccaaa
agtgttaatgctcaagtgactgacgttaaccccaaggggctggaattgaggaagactgtt
actacaattgagaatcagaacttggatgaccagtattacgtgccccaattctgccgtaag
ccctgtggtccaggtgaaaagaaagctagggattgcacaatggatggggatgaaccagac
tgcgtgccctgccaagaagggagggaatacactgacaaaagtcatttttcttccaaatgc
agaagatgtagattgtgtgacgaaggacatggcttagaagtggaaatcaactgcacccgg
acccagaataccaagtgcagatgtaaaccaaactttttttgtgattctgctgtatgtgaa
cactgtgacccttgtaccatatgtgaacatggaatcatcaaggaatgcacactaaccagc
aatgccaagtgcaaagaggaaggattcaaatatggcttgctgtggttgtgtctccttctt
ctcctaattccaccaattgcttgggaggtgagaagacgcataaagcacagaagggaaaac
caaggtcatcgtgaatctacaaccttaaattctgaaacggtgccaatgaatttatctgat
gttgacttgagtaaatatatcaccgttattgctgaacacatgacgataagtcaagttaga
gactttgttcggaagaatggtgtcaatgaagcaaaaatagatgagatcaagaatgacaat
atcaaagacacagcagaacagaaagttcagctgcttcgtaattggtatcaacttcatggg
aagaaagatgcatatgacactttgattaaaggtctcaaaaaagccaatcttactactctt
gcagagaaaattcagaatatcatcatcaaggactcagaaaattcaaacttcagaaatcaa
aatgaaaaccaaagcatggtctag

DBGET integrated database retrieval system