KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035660
Entry
101035660         CDS       T04350                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6 isoform X1
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01524  Platinum drug resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04060  Cytokine-cytokine receptor interaction
sbq04068  FoxO signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04217  Necroptosis
sbq04650  Natural killer cell mediated cytotoxicity
sbq04722  Neurotrophin signaling pathway
sbq04932  Non-alcoholic fatty liver disease
sbq04940  Type I diabetes mellitus
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05142  Chagas disease
sbq05143  African trypanosomiasis
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05162  Measles
sbq05163  Human cytomegalovirus infection
sbq05164  Influenza A
sbq05165  Human papillomavirus infection
sbq05168  Herpes simplex virus 1 infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05320  Autoimmune thyroid disease
sbq05330  Allograft rejection
sbq05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101035660 (FASLG)
   04014 Ras signaling pathway
    101035660 (FASLG)
   04068 FoxO signaling pathway
    101035660 (FASLG)
   04151 PI3K-Akt signaling pathway
    101035660 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101035660 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101035660 (FASLG)
   04217 Necroptosis
    101035660 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101035660 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101035660 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035660 (FASLG)
   05205 Proteoglycans in cancer
    101035660 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101035660 (FASLG)
   05330 Allograft rejection
    101035660 (FASLG)
   05332 Graft-versus-host disease
    101035660 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    101035660 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101035660 (FASLG)
   04932 Non-alcoholic fatty liver disease
    101035660 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101035660 (FASLG)
   05161 Hepatitis B
    101035660 (FASLG)
   05160 Hepatitis C
    101035660 (FASLG)
   05164 Influenza A
    101035660 (FASLG)
   05162 Measles
    101035660 (FASLG)
   05168 Herpes simplex virus 1 infection
    101035660 (FASLG)
   05163 Human cytomegalovirus infection
    101035660 (FASLG)
   05165 Human papillomavirus infection
    101035660 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101035660 (FASLG)
   05143 African trypanosomiasis
    101035660 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101035660 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101035660 (FASLG)
   04052 Cytokines and growth factors [BR:sbq04052]
    101035660 (FASLG)
   04090 CD molecules [BR:sbq04090]
    101035660 (FASLG)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101035660 (FASLG)
Cytokines and growth factors [BR:sbq04052]
 Cytokines
  Tumor necrosis fators
   101035660 (FASLG)
CD molecules [BR:sbq04090]
 Proteins
  101035660 (FASLG)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 101035660
NCBI-ProteinID: XP_003925407
UniProt: A0A2K6TR68
LinkDB
Position
Unknown
AA seq 289 aa
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPPLPPPPP
PPLPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFNLQKELA
ELRESTSQRHTASSVEKQIGHPSPPPERKEMRKVAHLTGKPNSRSMPLEWEDTYGIVLLS
GVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKLMSY
CTAGQMWARSSYLGAVFNLTSADRLYVNVSELSLVNFEESQTFFGLYKL
NT seq 870 nt   +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tctccctgggcccctccaggcacagtgcttccctgtccaacctctgtgcccagaaggcct
ggtcaaaggagaccaccaccaccgccaccgccaccgccaccactgccacctccaccaccg
ccaccactgccacctccaccaccaccaccactgcctccactaccactgccacccctgaag
aagagagggaaccacagcacaggcctgtgtctccttgtgatgttcttcatggttctggtt
gccttggtaggactgggactggggatgtttcagctcttcaaccttcagaaggagctggca
gaactccgagagtctaccagccaaaggcatacagcatcatctgtggagaagcaaataggc
caccctagtccaccccctgaaagaaaggagatgaggaaagtggcccatttaacaggcaag
cccaactcaaggtccatgcctctggaatgggaagacacctatggaattgtcctgctttct
ggagtgaagtataagaagggtggccttgtgatcaatgaaactgggctgtattttgtatat
tccaaagtatactttcggggtcagtcttgcaacaacctgcccctgagccacaaggtctac
atgaggaactctaagtatccccaggatctggtgatgatggaggggaagctgatgagctac
tgcactgctgggcagatgtgggctcgcagcagctacctgggggcagtgttcaatcttacc
agtgctgatcgtttatatgtcaatgtatctgagctctctctggtcaattttgaggaatct
cagacattttttggcttatataagctctaa

DBGET integrated database retrieval system