KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035780
Entry
101035780         CDS       T04350                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X2
  KO
K02157  axin 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq04390  Hippo signaling pathway
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04934  Cushing syndrome
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05217  Basal cell carcinoma
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101035780 (AXIN1)
   04390 Hippo signaling pathway
    101035780 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101035780 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101035780 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101035780 (AXIN1)
   05225 Hepatocellular carcinoma
    101035780 (AXIN1)
   05226 Gastric cancer
    101035780 (AXIN1)
   05217 Basal cell carcinoma
    101035780 (AXIN1)
   05213 Endometrial cancer
    101035780 (AXIN1)
   05224 Breast cancer
    101035780 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101035780 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    101035780 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101035780 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101035780 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbq01009]
    101035780 (AXIN1)
Protein phosphatases and associated proteins [BR:sbq01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101035780 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 101035780
NCBI-ProteinID: XP_003928394
UniProt: A0A2K6U9B8
LinkDB
Position
Unknown
AA seq 831 aa
MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPTSYSFCSGKGVGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDVDEDDGGDTAPPGRLPQKLLLETAAPRASSGRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPLTATWYHFPPRCVDVGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHAPKSGAKLDAAGLHHHRHVHHHVH
HSTARPKEQVEAEAARRAQSSFTWGPEPHIHGAKPRGYSESAGTAPNASDGLGHSGKVGV
ACKRNAKKAESGKNASTEVQGASEDAEKNQKIMQWIIEGEKEISRHRRAGHGSSGTRKPQ
SHENSRPLSLERSGAVHPWAGTQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLE
EEEKRASRAPSKQRARSQRKAGGGSAQACDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFK
ELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDGAVLPVFEEKIIGKVEKVD
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgaatgtccaggagcagggtttccccttggaccttggagcaagtttcaccgaagatgct
ccccgacccccagtgcctggtgaggagggagaactggtgtccacagacccaaggcccacc
agctacagtttctgctccgggaaaggtgttggcattaaaggtgagacttcgaccgccact
cccaggcgttcggatctggacctggggtatgagcctgagggcagtgcctcccccacccca
ccgtacttgaagtgggctgagtcactgcactccctgctggatgatcaagatgggataagc
ctgttcaggactttcctgaagcaggagggctgtgccgacttgctggacttctggtttgcc
tgcactggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gccagagccatctaccgaaagtacatccttgataacaatggcatcgtgtcccggcagacc
aagccggccaccaagagcttcataaagggctgcatcatgaagcagctgatcgatcctgcc
atgtttgaccaggcccagacagaaatccaggccactatggaggaaaacacctacccctcc
ttccttaagtctgatatttatttggaatatacgaggacaggctcagagagcccaaaggtc
tgtagtgaccagagctctgggtcagggacagggaagggcatttctggatacctgccgact
ttaaacgaagatgaggaatggaaatgtgaccaggatgtggatgaggacgatggcggagac
actgctcctcctggaagactccctcagaagctgctcctggagacagctgccccgagggcc
tcctccggtcgacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcca
gtcaacccctattatgtcaacgccggctatgctctggccccggccaccagtgccaacgac
agcgagcagcagagcctgtccagcgatgcggacaccctgtccctcacggacagcagcgtg
gatgggatccccccatacaggatccgtaagcagcaccgcagggagatgcaggagagcgtg
caggtcaacgggcgcgtgcccctacctcacattccccgcacgtaccgggtgccaaaggag
gtccgcgtggagccgcagaagtttgccgaggaactcatccaccgcctggaggctgtgcag
cgcacgcgggaggctgaggagaagctggaggagcggctcaagcgcgtgcgcatggaggag
gaaggtgaagacggcgacccatcatcgggtcccccagggccgtgtcacaagctgcctctc
accgccacctggtaccactttccaccccgctgtgtggatgtgggctgtgccgggctccgg
gacgcacacgaggagaaccccgagagcatcctggatgagcacgtgcagcgtgtgctgagg
acaccgggtcgccagtcaccagggcctggccaccgctccccggacagtgggcacgtagcc
aagatgccagtggcactgggaggtgcagcctcggggcacgggaagcacgcgcccaagtca
ggggcgaagctggatgcggccggcctgcaccaccaccgacacgtccaccaccacgtccac
cacagcacagcccggcccaaggagcaggtggaggctgaggctgcccgcagggcccagagc
agcttcacctggggcccggagccccacatccatggggcaaagccccgaggctactcagag
agtgcgggcactgcccccaacgccagcgatggcctgggccacagtgggaaggtgggcgtg
gcatgcaaaagaaacgccaagaaggccgagtcggggaagaacgccagcaccgaggtgcaa
ggcgcctcggaggacgcggagaagaaccagaagatcatgcagtggatcatcgagggcgag
aaggagatcagcaggcaccggagggccgggcacgggtcttcagggacgaggaagccacag
tcccatgagaactccagacccttgtccctcgagcgctccggggccgtgcacccctgggct
ggcactcagctccggacctccgtgcagccctcccacctctttatccaagaccccacgatg
ccaccccacccagctcccaaccccctaacccagttggaggaggcgcgccgacgtctggaa
gaagaagaaaaaagagccagccgggcaccctccaagcagagggcgaggtcgcagcggaag
gcaggtggtgggagcgcccaggcatgtgacagcatcgtcgtggcctactacttctgcggg
gagcccatcccctaccgcaccctggtgaggggccgcgccgtcaccctgggccagttcaag
gagctgctgaccaaaaagggcagctaccgatactacttcaagaaagtgagcgacgagttt
gactgtggggtggtgtttgaggaggtccgagaggatggggctgtcctgcccgtgttcgag
gagaagatcatcggcaaagtggagaaggtggactga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036328
Entry
101036328         CDS       T04350                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq04390  Hippo signaling pathway
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04934  Cushing syndrome
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05210  Colorectal cancer
sbq05213  Endometrial cancer
sbq05217  Basal cell carcinoma
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101036328 (AXIN2)
   04390 Hippo signaling pathway
    101036328 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101036328 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036328 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101036328 (AXIN2)
   05225 Hepatocellular carcinoma
    101036328 (AXIN2)
   05226 Gastric cancer
    101036328 (AXIN2)
   05217 Basal cell carcinoma
    101036328 (AXIN2)
   05213 Endometrial cancer
    101036328 (AXIN2)
   05224 Breast cancer
    101036328 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101036328 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    101036328 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101036328 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101036328 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101036328 (AXIN2)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101036328 (AXIN2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind DUF4827
Other DBs
NCBI-GeneID: 101036328
NCBI-ProteinID: XP_003931852
UniProt: A0A2K6V194
LinkDB
Position
Unknown
AA seq 842 aa
MSSAVLVTRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKSQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHCLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVSPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEASELTLSSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHPQYHSLL
PPGGKLPPANASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHC
FCPGGSEYYCYSKCKSHSKAPETVPGEQFGGSRGSTLPKRNGKGTEPGLTLPAREGGAPG
GAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKRTYPLESARSSPGERASRHH
LLGGNGGHPRSAPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCLASQQ
RDRSHSAAVQVGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRML
KAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEVWDDETVLPMYDGRILGKVER
ID
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgagtagcgcggtgttggtgactcgcctcccggaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
gggaagagccaggtcaccaaacccatgcctgtctcttccaacaccaggcggaacgaagat
gggctgggggagccggaggggcgagcatcccctgattcccctctgaccaggtggaccaag
tccttgcactgcttgttgggcgatcaagacggtgcttacctcttccggactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagacggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagacggagatccagtcg
gtgatggaggaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaacgggggactggggagcctaaaggtg
gtgtgtggctatctccccaccttgaacgaagaagaggagtggacttgtgccgacttcaag
tgcaaactttcgccaactgtggttggcttgtccagcaaaactctgagggcgacagcaagt
gtgaggtccacggaaacggttgacagtggatacaggtccttcaagaggagcgatcccgtt
agcccttaccacgtaggttccggctatgtctttgcaccagccaccagcgccaatgacagt
gaaatatccagtgacgcgctgacggatgattccatgtccatgacagacagcagcgtagat
ggaattcctccttatcgcgtggggagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcattttccgagaacccaccgcctgcccaag
gagatgacccccgtggaacccgccacctttgcggctgagctcatctcgaggctggagaag
ctgaaactggagctggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagaaggaggcctctgagcttacactcagttcgcgggagggggcacccacgcag
caccccctttccctactgccctccggcagctacgaggaggacccgcagacaatcctggac
gatcacctgtccagggtcctcaagacccctggctgccagtccccgggcgtaggccgctac
agtccccgctcccgctccccggaccaccaccaccaccacccgcagtaccactccctgctc
ccgcccggtggtaagctgcctcccgccaacgcctcaccaggcgcctgccccctcctcggg
ggcaagggctttgtgaccaagcagacgacgaagcatgtccaccaccactatatccaccac
cacgccgtccctaagaccaaggaggagatcgaggcggaggccacgcagcgggttcactgc
ttctgccccgggggctctgagtattactgctactcaaaatgcaaaagccactctaaggct
ccggaaaccgtgcctggcgagcagtttggcggcagcagaggcagtactttgcccaaacgc
aatgggaaaggcacggagccgggcctgactctgcccgccagggaaggaggggcccccggc
ggagccggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctggcag
tggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcacaaaa
aggacctacccgttggaatctgcccgctcgtctccgggcgaacgagccagccggcaccac
ctgttagggggcaatggtgggcacccccgcagcgccccccgtgctcacctgttcacgcag
gaccctgcaatgcctcccctgaccccacccaacactctggctcaactggaggaggcctgt
cgcaggctggctgaggtgtctaagcccccaaaacagcggtgctgcctggccagtcagcag
agggacaggagtcactcggccgctgtccaggtgggagccacgcccttctccaatccgagc
ctggctccagaagatcacaaagagccaaagaagctggcaggtgtccacgcgctccaggcc
agtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatgctg
aaggctcagagtttgaccctgggccactttaaagagcagctcagcaaaaagggaaattat
aggtattacttcaaaaaagcaagtgatgagtttgcctgtggagcggtttttgaggaggtc
tgggacgacgagacagtgctcccaatgtatgacggccggattctgggcaaagtggagcgg
atcgattga

DBGET integrated database retrieval system