KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101035784Help
Entry
101035784         CDS       T04350                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00052  Galactose metabolism
sbq00500  Starch and sucrose metabolism
sbq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101035784 (GANC)
   00500 Starch and sucrose metabolism
    101035784 (GANC)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101035784 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 101035784
NCBI-ProteinID: XP_003929013
UniProt: A0A2K6TJS9
LinkDB All DBs
Position
Unknown
AA seq 914 aa AA seqDB search
MEAAEKEEISVKDEAVDKNIFRDCNRIAFYRRQKQWLSKKSTYQVLLDSVTTVEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEESPLKPRYEVPDVLTSKPSTVRLIPSLGDTGS
LILANEKGDLRCHITANPFKIDLVSEEEVVMSINSLGQLYFEHLQILHKQRTAKENEEEA
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHEFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIHDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFRQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKKRFANPKK
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVRNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPNELKTFDMEDEYMLGSA
LLIHPVTEPKATIVDVFLPGSNEVWYDCKTFACWEGGCTVKIPVALDTIPVFQRGGSVVP
IKTTIGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQQQFLHRKFSFCSSV
LINSSADQRGHYPSKCVVEQILVLGLRKEPSSVITHSSDGKDQPVAFMYCAKTSTLSLKN
LSLNIATDWEVHII
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgagaaggaggaaatcagtgtcaaagatgaagctgtggataaaaacatt
ttcagagactgcaacaggatcgcattttacaggcgtcagaaacagtggctttccaagaag
tccacctatcaggtattactagactcagtcacaacagttgaagacagcaccaggttccaa
atcatcaatgaagcaagtaaggttcctctcctggctgaaatttatggtatagaaggaaac
attttcaggcttaagattaatgaagagagtcctctaaaacccaggtatgaagttcctgat
gtcctcacaagcaagccaagcactgtaagactgattccatccttaggggatacaggcagt
ctgatattggcaaatgaaaaaggagacctcaggtgtcatatcacagcaaatccattcaag
atagacttggtgtctgaagaagaggttgtgatgagcataaattccctgggccaattatac
tttgagcatctacagattcttcacaaacaaagaactgctaaagaaaacgaggaggaggca
tcagtggacacctctcaggaaaatcaagaggatctgggcctttgggaagagaaatttgga
aaatttgtggatatcaaagctaatggcccttcttccattggtttggatttctccttgcat
gaatttgagcatctgtatggtatcccacaacatgcagaatcacaccaacttaaaaatact
ggggatggagatgcttaccgtctttataacctggatgtctatggataccaaatacatgat
aaaatgggcatttatggttcagtaccttatctcctggctcacaaactgggcagaactata
ggtattttctggctaaatgcctcagaaacactggtggagatcaatacagagcctgcagta
gagtacacactgacccagatgggcccagttgctgctaaacaaaaggtcagatctcgaact
catgtgcactggatgtcagaaagtggaatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcagacagtactcacaccttacaggtacacaagctatgccccctctt
ttctctttgggttaccaccagtgccgctggaattacgaagatgagcaggatgtaaaagca
gtggatgcagggtttgatgagcatgacattccttatgatgccatgtggctggacatagag
cacactgagggcaagaggtacttcacctgggacaaaaaaagattcgcaaaccccaagaag
atgcaagagctgctcaggagcaaaaaacgtaagcttgtggtcatcagtgatccccacatc
aagattgatcctgactactcagtatatgtgaaggccaaagatcagggcttctttgtgagg
aatcaggaaggggaagactttgaaggggtgtgctggcctggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaagtctttttgctttccctgtgtatcag
ggatctacagatatcctcttcctttggaatgatatgaatgagccctctgtctttagaggg
ccagaacaaaccatgcagaagaatgccattcatcatggcaattgggagcacagagaactc
cacaacatctacggcttttatcaccaaatggctactgcagaaggactgatacagcgatct
aaagggaaggaaagaccctttgttcttacacgttctttctttgctggatcacagaagtat
ggtgccgtgtggacaggtgacaacacagcagaatggagctacctgaaaatttctatccca
atgttactcactctcagcattactgggatctctttttgtggagctgacataggtgggttc
attgggaatccagagacagagctgctagtgcgttggtaccaggctggagcctaccagcct
ttcttccgtggccatgctaccatgaacaccaagcggcgggagccctggctctttggggag
gaacacacccggctcatccgagaagccatcagagagcgctatggcctcctgccatattgg
tattctctgttctaccatgcacacgtggcttcccaacctgttatgaggcctctgtgggta
gagttccccaatgaactaaagacttttgatatggaagatgaatacatgctggggagtgca
ttgttgattcatccagtcacagaaccaaaagccaccatagttgatgtgtttctgccagga
tcgaatgaggtctggtatgactgtaagacatttgcttgttgggaaggagggtgtactgta
aagattccagtagccctggacactataccagtgtttcagcgaggtggaagtgtggtacca
ataaagacaaccataggaaaatccacaggctggatgactgaatcttcctatggactccgg
gttgctctaagcacaaagggttcttcagtgggtgagttatatcttgatgatggccattca
ttccagtacctccaccagcagcaatttttgcacaggaagttttcattctgttccagtgtt
ttgatcaatagttctgccgaccagaggggtcattatcccagcaagtgtgtggtggagcaa
atcttggtcttaggcctcaggaaggagccatcttctgtgattacccactcatccgatggt
aaagatcagcctgtggcttttatgtattgtgccaaaacatccaccctgagcctgaagaat
ctctcactcaacattgccactgactgggaggtccacatcatatga

DBGET integrated database retrieval system