KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036015
Entry
101036015         CDS       T04350                                 

Gene name
CSNK1A1L
Definition
(RefSeq) casein kinase I isoform alpha-like
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05165  Human papillomavirus infection
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101036015 (CSNK1A1L)
   04340 Hedgehog signaling pathway
    101036015 (CSNK1A1L)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101036015 (CSNK1A1L)
   05226 Gastric cancer
    101036015 (CSNK1A1L)
   05224 Breast cancer
    101036015 (CSNK1A1L)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101036015 (CSNK1A1L)
   05022 Pathways of neurodegeneration - multiple diseases
    101036015 (CSNK1A1L)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101036015 (CSNK1A1L)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101036015 (CSNK1A1L)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101036015 (CSNK1A1L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH ABC1 Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 101036015
NCBI-ProteinID: XP_003934460
LinkDB
Position
Unknown
AA seq 335 aa
MMNSGSKAELIVGGKYKLVRKIGSGSFGDVYLGVTTTTGEEVAVKLESQKAKHPQLLYES
KLYTILQGGIGIPHMHWYGQEKDSNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMI
SRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHL
IGTVRYASINTHLGIEQSRRDDMESLGYVFMYFNRTNLPWQGLKAMTKKQKYEKISEKKM
STPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTML
KQKAAQQAASSSGQGQQAQTQTGKQTEKKNNVKDN
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgatgaacagcggctccaaggccgaactcatcgtgggagggaaatacaaactggtgcgg
aagatcgggtccggctccttcggagacgtttatctgggagtcaccaccaccacgggcgag
gaagtggcagtgaagctggaatctcagaaggccaagcacccccagctgctgtatgagagc
aaactctacacgattcttcaaggtgggattggcatcccccacatgcactggtacggtcag
gaaaaagacagcaacgtgctagtcatggaccttctgggacccagcctcgaagacctcttt
aatttctgttccagaaggttcaccatgaaaactgtacttatgttggccgaccagatgatc
agtagaattgaatacgtgcatacgaagaattttctacaccgagacattaaaccagataac
ttcctgatgggtaccgggcgtcactgtaataagttgttccttattgattttggtttggcc
aaaaagtacagagacaacaggaccaggcaacacataccgtacagagaagataaacacctc
attggcactgtccgatatgccagcatcaatacgcatcttggtattgagcagagccggcga
gatgacatggaatccttaggctacgttttcatgtattttaatagaaccaacctgccgtgg
caaggactaaaggctatgacaaagaaacaaaaatatgaaaagattagtgagaagaagatg
tccacccctgttgaagttttatgtaagggatttcctgcggaatttgccatgtacttgaat
tactgtcgtgggctgcgctttgaggaagtcccagattacatgtatctgaggcagctcttc
cgcattcttttcaggaccctgaaccaccaatatgactacacatttgattggacgatgtta
aagcagaaagcagcacagcaggcagcctcttccagtgggcagggtcagcaggcccaaacc
cagacaggcaagcaaacggaaaaaaagaataatgtgaaagataactaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037076
Entry
101037076         CDS       T04350                                 

Gene name
CSNK1A1
Definition
(RefSeq) casein kinase I isoform alpha isoform X1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04310  Wnt signaling pathway
sbq04340  Hedgehog signaling pathway
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05165  Human papillomavirus infection
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101037076 (CSNK1A1)
   04340 Hedgehog signaling pathway
    101037076 (CSNK1A1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101037076 (CSNK1A1)
   05226 Gastric cancer
    101037076 (CSNK1A1)
   05224 Breast cancer
    101037076 (CSNK1A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101037076 (CSNK1A1)
   05022 Pathways of neurodegeneration - multiple diseases
    101037076 (CSNK1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101037076 (CSNK1A1)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101037076 (CSNK1A1)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   101037076 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 101037076
NCBI-ProteinID: XP_010342830
UniProt: A0A2K6TCE9
LinkDB
Position
Unknown
AA seq 365 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaattcattgtcggagggaaatacaaactggta
cggaagatcgggtctggctccttcggggacatctatctggcgatcaacatcaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaagctctataagattcttcaaggtggggttggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtactagtcatggatcttctgggacctagccttgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtacttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggtactgcccgatatgctagcatcaatgca
catcttggtattgagcagagtcgccgagatgacatggaatcattaggatatgttttgatg
tattttaatagaaccagcctgccatggcaaggtctaaaggctgcaacaaagaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaagttttatgtaaggggttt
cctgcagaatttgccatgtacttaaactattgtcgtgggctacgctttgaggaagcccca
gattacatgtatctgaggcagctattccgcattcttttcaggaccctgaaccatcaatat
gactacacatttgattggacaatgttaaagcagaaagcagcacagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaaccccgacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtttctaa

DBGET integrated database retrieval system