KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036161
Entry
101036161         CDS       T04350                                 

Gene name
ETS1
Definition
(RefSeq) protein C-ets-1
  KO
K02678  C-ets-1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04014  Ras signaling pathway
sbq04218  Cellular senescence
sbq05166  Human T-cell leukemia virus 1 infection
sbq05200  Pathways in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101036161 (ETS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101036161 (ETS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036161 (ETS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101036161 (ETS1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101036161 (ETS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sbq03000]
    101036161 (ETS1)
Transcription factors [BR:sbq03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101036161 (ETS1)
SSDB
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Other DBs
NCBI-GeneID: 101036161
NCBI-ProteinID: XP_003923567
UniProt: A0A2K6TC32
LinkDB
Position
Unknown
AA seq 441 aa
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF
VGDILWEHLEILQKEDVKPYPVNGVNPTYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR
TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaagccgactctcaccatcatcaagacggaaaaagtcgat
ctggagcttttcccctccccggatatggaatgtgcagatgtcccactcttaactccaagc
agcaaagaaatgatgtctcaagcattaaaagctactttcagtggtttcactaaagaacag
caacgactggggatcccaaaagacccccggcagtggacagaaactcatgttcgggactgg
gtgatgtgggctgtgaatgaattcagcctgaagggcgtggacttccagaagttctgtatg
aacggagcagccctctgtgccctgggtaaagactgctttctcgagctggccccagacttt
gttggggacatcttatgggaacatctagagatcctgcagaaagaagatgtgaaaccatat
ccagttaatggcgtcaacccaacctatccagaatcccgctatacctcggattacttcatt
agctatggtattgagcatgcccagtgtgttccaccgtcggagttctcagagcccagcttc
atcacagagtcctatcagacactccatcccatcagctcagaagaactcctctccctcaag
tatgagaacgactatccttcggtcattctccgggaccctctccagacagacaccttgcag
aacgactactttgctatcaaacaagaagtcgtcaccccagacaacatgtgcatggggaga
accagtcgtggtaaactcgggggccaggactcttttgagagcatagagagctacgatagt
tgtgatcgtctcacccagtcctggagcagccagtcatctttcaacagcctgcagcgtgtt
ccctcctatgacagcttcgactcagaggactatccagctgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgggaccgtgctgacctcaacaaggacaagcctgtc
attcctgctgctgccctagctggctacacaggcagtggaccaatccagctgtggcagttt
cttctggaattactcactgataaatcctgtcagtcttttatcagctggacaggagatggc
tgggaattcaaactttctgacccagatgaggtggccaggagatggggaaagaggaaaaac
aaacctaagatgaattatgagaaactgagccgtggcctacgctactattatgacaaaaac
atcatccacaagacagccgggaaacgctacgtgtaccgctttgtgtgtgacctgcagagc
ctgctgggatacacccctgaggagctgcacgccatgctggatgtcaagccagatgccgat
gagtga

DBGET integrated database retrieval system