KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036245Help
Entry
101036245         CDS       T04350                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X2
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04371  Apelin signaling pathway
sbq05034  Alcoholism
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101036245 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    101036245 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    101036245 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    101036245 (HDAC4)
   05165 Human papillomavirus infection
    101036245 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbq03036]
    101036245 (HDAC4)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101036245 (HDAC4)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101036245 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101036245
NCBI-ProteinID: XP_003936809
UniProt: A0A2K6TNS9
LinkDB All DBs
Position
Unknown
AA seq 1083 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCLSSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGNVSAENGIAPAVPSIPVETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGAAGQQDAERLALPALQQRLSLFPGTHLTPYLSTSPLERDGGTAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGKEAHTPGGVQVKQEPIESDDEEAEAPQEVEPGQRQPSEQELLFRQQALLLEQQR
IHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSAQESPAKPRFTTGLVYDTL
MLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTL
LYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVEL
VFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWDV
HHGNGTQQAFYSDPSVLYVSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPP
MGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLM
GLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVM
EIHSKYWRCLQRAASTAGRSLIEAQTCENDEAETVTAMASLSVGVKPAEKRPDEEPMEEE
PPL
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggacgtggccacggcgctgcctctg
caggtggcgccctcggcagtgcccatggacctgcgtctggaccaccagttctctctgcct
gtggcggagcctgccctgcgggagcagcagctacagcaggagctcctggcactcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccgccagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggagcaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttgcaagagtttgtcctc
aataaaaagaaggcgctggcgcaccggaacctgaaccactgcctctctagcgaccctcgc
tactggtacgggaaaacgcagcacagttccctcgatcagagttctccaccccagagcgga
gtgtcggcctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattgcggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccttgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactctgcctgcagcagcgcccccggctctgggccc
agctcacccaacaacagctccgggaacgtcagcgccgagaatgggatcgcacctgccgtc
cccagcatcccggtggagacgagtttggcgcaccgactcgtggcgcgagaaggctcggcc
gctccgcttcccctctacacgtcgccctccctgcccaacatcacgctgggcctgcctgcc
accggcccttccgccggtgcagcgggccagcaggacgccgagagactcgccctccctgcc
ctccagcagaggctctcccttttccctggcacccacctcactccctacctgagcacctcg
cccttggagcgggatggaggcacagcgcacagccctcttctgcagcacatggtcctactg
gagcagcccccggcacaagcgcccctcgtcacaggcctgggagctctgcccctccacgca
cagtccctggttggtgcggaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccactggggcggacccagtcggccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacataagcagcagttccagcagcag
caactgcacatgaacaagatcatccccaagccaagcgagccagcccggcagccagagagc
caccccgaggagacggaggaggaactccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccggggaaggaggcgcacacaccgggcggcgtgcaggtgaagcaggag
cccatcgagagcgacgacgaagaggcagaggccccgcaggaggtggagccaggccagcgc
cagcccagtgagcaggagctgcttttcagacagcaagctctcctgctggagcagcagcgg
atccaccagctgaggaactaccaggcgtccatggaggccgctggcatccccgtgtccttc
ggcggccaccggcctctgtcccgggcacagtcgtcgccggcgtccgccaccttccccgtg
tctgcgcaagagtcccccgccaagccgaggttcacgacaggcctcgtgtacgacacgctg
atgctgaagcaccagtgcacctgcgggagcagtagcagccaccccgagcatgccgggagg
atccagagcatctggtcccgcctgcaggagactggcctccgaggcaaatgcgagtgcatc
cgcggacgcaaggccaccctggaggagctgcagacggtgcactcggaggcccacaccctc
ctgtacggcacgaaccccctcaaccggcagaaactggacagtaagaaacttctaggctcg
ctggcctccgtgttcgtccggctcccctgcggtggtgttggggtggacagtgacaccatc
tggaatgaggtgcactcagcaggggccgcccgcctggccgtgggctgcgtagtggagctg
gtcttcaaggtggccacgggggagctgaagaatggctttgctgtggtccgcccccctgga
caccacgcggaggagagcacgcccatgggtttttgctacttcaactccgtggccgtggca
gccaagcttctgcagcaaaggttgagcgtgagcaagatcctcatcgtggactgggacgtg
caccacggaaacgggacccagcaggctttctacagtgaccccagcgtcctgtacgtgtcc
cttcaccgctacgatgatgggaacttcttcccaggcagcggcgctcctgacgaggtgggc
acagggccaggcgtgggtttcaacgtcaacatggctttcactggcggcctggaccccccc
atgggagatgccgagtacttggcggccttcagaacggtggtcatgccgatcgccagcgag
tttgccccggacgtggtgctggtgtcatcgggcttcgacgccgtggagggccaccccacg
cctctcgggggctacaacctctccgccagatgtttcgggtacctgacgaagcagctaatg
ggcctggctggtggccggattgtcctggccctcgagggaggccacgacctgaccgccatc
tgcgacgcctccgaagcatgtgtttctgctctgctgggaaatgagcttgatcccctccca
gaaaaggttttacagcaaagacccaatgccaacgctgtccgctccatggagaaggtcatg
gaaatccacagcaagtactggcgctgcctgcaacgtgcagcctctacggcggggcgctcc
ctgatcgaggctcagacctgtgagaacgacgaagccgagacggtcaccgccatggcctcg
ctgtctgtgggcgtgaagcccgccgaaaagagaccagacgaggagcccatggaagaggag
ccgcccctgtag

DBGET integrated database retrieval system