KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036353
Entry
101036353         CDS       T04350                                 

Gene name
PRCC
Definition
(RefSeq) proline-rich protein PRCC
  KO
K13105  proline-rich protein PRCC
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05202  Transcriptional misregulation in cancer
sbq05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101036353 (PRCC)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101036353 (PRCC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sbq03041]
    101036353 (PRCC)
Spliceosome [BR:sbq03041]
 Complex B
  Other components
   Prp19-related factors
    101036353 (PRCC)
SSDB
Motif
Pfam: PRCC
Other DBs
NCBI-GeneID: 101036353
NCBI-ProteinID: XP_003937908
UniProt: A0A2K6UTI0
LinkDB
Position
Unknown
AA seq 491 aa
MSLVAYASSDESEPDEAEPEPEEEEAVAPPSGPVLGGLFASLPAPKGPALLPPPPQMLAP
AFPPSLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGL
SLPPPMGGAGPPMGLPKPKKRKEPVKIAAPELHKGDSDSEEDEPTKKKTILQGSGEGTGL
SALLPQPKNLTVKETNRLLLPHAFSRKPSDGSPDTKPSRLASKTKTSSLAPVVGTTTTTP
SPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLPEKAEPPGVEPYPYPIPTVPE
ELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYY
QDYYSGGYYPAQDPALVPSQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKL
SRRQTQAKYGF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtcgctggttgcttacgccagcagcgatgagagcgagccggatgaggctgagcccgag
ccggaggaagaggaggcggtggcccctccatctgggcccgttttagggggcttgttcgct
tctctccctgcgcccaagggcccggccttgctgcctccgcccccccagatgctggcccca
gcctttcccccgtcgctcttgcttcccccacccaccggagaccccaggcttcagcctccc
ccgcccttgcccttcggcctgggaggcttccccccacctccaggcgtgagcccggctgaa
gcggcgggagttggggagggactgggattggggttgccctcgccccggggccctggcctc
agtctgccccctccaatgggcggtgccggccccccgatggggcttcccaagccaaagaag
aggaaagagcccgtgaagatcgcggcgccggagttgcataaaggagattcagattctgag
gaagatgaacccacaaagaagaaaactattcttcagggatccggcgaggggactggtttg
tctgccttgcttccccaacctaaaaacctgactgtgaaagagactaacaggttgctcctg
ccccatgccttctcccgaaaaccctcggatggctcccctgatactaagccctccagactg
gcgtctaagaccaagacttcctctcttgcccctgttgtgggcaccacaaccaccactccg
tcaccctctgctatcaaggctgctgccaagagtgctgccctgcaggtgacaaagcagatc
acgcaggaggaagatgacagtgatgaagaagtagcccctgaaaactttttctccctccct
gaaaaggctgagccacctggagttgagccatacccttatcccatccccacggtccctgag
gagctgcctccaggcacagaaccagaaccggctttccaggacgatgcagccaatgccccc
cttgaattcaagatggcagcaggctcaagtggcgccccttggatgcctaagcctggggac
gactacagctacaatcagttttccacatatggcgatgccaatgccgctggtgcttattat
caggattattacagtggtggctactatcctgcacaggacccggccctggtcccctcacag
gaaattgccccagatgcctccttcatcgatgacgaagcatttaagcggctacagggcaag
aggaaccgagggagggaagaaatcaactttgtagagatcaaaggtgatgaccagctcagt
ggggcccagcaatggatgactaagtcgttgacagaagagaaaaccatgaagtccttcagc
aaaaagaaaggtgagcagccaacaggccagcagcggcggaaacaccagatcacatatctg
attcatcaggccaaggagcgggagctggaactgaagaacacatggtcagagaacaagctc
agccgtcgtcagacccaagccaaatacggattctag

DBGET integrated database retrieval system