KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036389Help
Entry
101036389         CDS       T04350                                 

Gene name
ACAA2
Definition
(RefSeq) 3-ketoacyl-CoA thiolase, mitochondrial
  KO
K07508  acetyl-CoA acyltransferase 2 [EC:2.3.1.16]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00062  Fatty acid elongation
sbq00071  Fatty acid degradation
sbq00280  Valine, leucine and isoleucine degradation
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
Module
sbq_M00085  Fatty acid elongation in mitochondria
sbq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    101036389 (ACAA2)
   00071 Fatty acid degradation
    101036389 (ACAA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101036389 (ACAA2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     101036389 (ACAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 101036389
NCBI-ProteinID: XP_010335135
UniProt: A0A2K6TZV8
LinkDB All DBs
Position
Unknown
AA seq 397 aa AA seqDB search
MALLRGVFVIAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIVGNVL
QSSSDALYLARHVGLRVGIPKESPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE
SMSQAPFCVRSVRFGTKLGSDIKLEDYLWVALTDQHIKIPMAITAENLAVKHKISREECD
KYALQSQQRWKAANDAGCFNDEMAPIEVKTKKGKQTVEVDEHARPQTTLEQLQKLPPVFK
KDGTVTAGNASGIADGAGAVIIASEDAVKKHNFIPLARIVSYFVAGCDPSIMGIGPVPAI
SGALKKAGLSLKDMDLVEVNEAFAPQYLAVQKSLDLDPSKTNVNGGAIALGHPLGGSGSR
ITAHLVHELRRRGGKYAIGSACIGGGQGIAVIIQNTA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctccgaggtgtgtttgtcattgctgctaagcgaacgccctttggagcttac
ggaggtcttctgaaagactttactgctactgacttgtctgaatttgctgccaaggctgcc
ttgtctgctggcaaagtctcacctgaaactgttgacagtgtgattgtaggcaatgtcttg
cagagttcttcagatgcgctgtatttggcaaggcatgttggtttacgtgtgggaatccca
aaggagagcccagccctcacgattaacaggctctgtggttctggttttcagtctattgtg
aatggatgtcaggaaatttgtgtgaaagaagctgaggtggttttatgtggaggaactgaa
agcatgagccaagctcccttctgtgtcagaagtgtgcgttttggaaccaagcttggatca
gatatcaagctggaagattatttgtgggtagcattaacagatcagcatataaaaatcccc
atggcaattactgcagagaatcttgctgtgaaacacaaaataagcagagaagaatgtgac
aaatatgctctgcagtcgcagcagagatggaaagctgctaatgatgctggctgctttaat
gatgaaatggcaccaattgaagtgaagacaaagaaaggaaaacagacagtggaggtagat
gagcatgctcggccccaaacaaccctggagcagttacagaaacttcctccagtcttcaag
aaggatggaactgtcactgcagggaatgcatcggggatagctgatggtgctggagctgtt
atcatagctagtgaagatgctgttaagaaacataacttcataccactggcaagaatcgtg
agctactttgtagctggatgtgatccctctatcatgggtattggtcctgtccctgctatc
agtggggcactgaagaaagcaggactgagtcttaaggacatggatttggtggaggtgaat
gaagcttttgctccccagtacttggctgttcagaagagtttggatcttgatccaagtaaa
accaatgtgaatggaggagccattgctttgggtcacccactgggaggatctggatcaaga
attactgcacacctggttcatgaattaaggcgtcgaggtggaaagtatgccattggatca
gcttgcattggaggtggccaaggtatcgctgtcatcattcagaacacagcctaa

DBGET integrated database retrieval system