KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036391
Entry
101036391         CDS       T04350                                 

Gene name
DLL3
Definition
(RefSeq) delta-like protein 3
  KO
K06051  delta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04330  Notch signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq05200  Pathways in cancer
sbq05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101036391 (DLL3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101036391 (DLL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036391 (DLL3)
  09162 Cancer: specific types
   05224 Breast cancer
    101036391 (DLL3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101036391 (DLL3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 MNNL EGF_CA EGF_3 cEGF
Other DBs
NCBI-GeneID: 101036391
NCBI-ProteinID: XP_010329396
LinkDB
Position
Unknown
AA seq 415 aa
MVFPRMSQLLSQTVILAIFFLPQARPAGVFELQIHSFGPGPGPGAPWSPCSARGPCRLFF
RVCLKPGLSEEATESPCAPGAALSARGPAYTEQAGAPAPDLPLPDGLLRVPFRDAWPGTF
SLIIETWRQELGDQIGARSAPSRCGPGLRPCAQLEEECEAPTECQAGCSPEHGFCERPGE
CRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTRCLVPGPGPCDGNPCANGGSCSETPGSF
ECTCPRGFYGRLCQVSGVTCADGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCEKRVDR
CSLQPCRNGEAWRPERPGMGLPPALGLLVAAGVAGAALLLVHVRRRGQAQDAGSRLLAGS
PEPSVHALPDALNNLRTQEGPGDGRSSSIDWNRPEDGDSRGIYVLSAPSIYAREA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggtcttcccacggatgtcccagcttctgtcccagaccgtgatcctagcgatctttttt
ctcccccaggcacggcccgctggcgtcttcgagctgcagatccattctttcgggccgggt
ccaggcccgggggccccgtggtccccctgcagcgcccggggcccctgccgcctcttcttc
agagtctgcctgaagcccggactctcggaggaggccaccgagtccccgtgcgccccgggc
gcggcgctgagtgcgcgcggacctgcctacaccgagcaggccggagcacccgcgcctgat
ctgccgctgcccgacggcctcttgcgggtgcccttccgggacgcctggccgggcaccttc
tctctcatcattgaaacctggagacaggagttaggagatcagattggagcacgcagcgcc
ccctcgcggtgcggcccgggactgcgcccttgcgcgcagctggaggaggagtgtgaggcg
ccaacagagtgccaagcaggctgcagcccggagcacggcttctgtgagcggcctggtgaa
tgccgatgcctggagggctggactgggcccctctgcacggtccctgtgtccaccagcagc
tgcctcagtcccagggggccgtcctctgccaccaccagatgccttgtccctgggcctggg
ccctgtgatgggaacccgtgtgccaacgggggcagctgtagtgagacacccgggtccttt
gaatgcacctgcccacgtgggttctacgggcggctgtgtcaggtgagcggggtgacatgc
gcggatggaccctgcttcaacggcggcttgtgtgtcgggggcgcagaccctgactctgct
tacgtctgccactgcccacctggtttccaaggctccaactgtgagaagagggtggaccgg
tgcagcctgcagccatgccgcaatggtgaggcctggaggccagaacggcccgggatgggg
ttgcctccggctctgggactgctggtggccgcgggcgtggccggcgccgcgctcttgctg
gtccacgtgcgccgccgtggtcaagcccaggatgctgggtctcgcttgctggcggggtcc
ccggagccgtcagtccacgcacttccggatgcactcaacaacctaaggacgcaggagggt
cccggggatggccggagctcgtccatagattggaatcgtcctgaagatggagactctcga
gggatttacgtcctatctgctccttctatctacgctcgggaggcctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101041321
Entry
101041321         CDS       T04350                                 

Gene name
DLL1
Definition
(RefSeq) delta-like protein 1
  KO
K06051  delta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04330  Notch signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq05200  Pathways in cancer
sbq05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101041321 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101041321 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101041321 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    101041321 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101041321 (DLL1)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_CA EGF_3 EGF_2 ECSCR
Other DBs
NCBI-GeneID: 101041321
NCBI-ProteinID: XP_003943483
UniProt: A0A2K6T7L1
LinkDB
Position
Unknown
AA seq 723 aa
MGGRCALALAVFSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGAPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGADPAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGLYCTEPICLPGCDEQHGFCDRP
GDCKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQVGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAMVVCIRLRLQKRRPPAEPCRGETETMNNLANCQREK
DISVSVIGATQIKNTNKKADLHGDHGADKNGFKARYPTVDYNLVQDLKGDEAGVRDMHSK
RDTKCQPQGSSGEEKGNPTTLRGGEASERKRPDSACSTSKDTKYQSVYVISEEKDECVIA
TEV
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgggcggccggtgcgcgctggctctcgcggtgttctcggccttgctgtgtcaggtctgg
agctcgggggtgttcgagctgaagctgcaagagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggcgcgggggcgccgccgtgcgcctgccgcaccttcttc
cgcgtgtgcctcaagcactaccaggccagcgtgtccccggagccgccctgcacctacggc
agcgccgtcacgccagtgttgggcgtcgactccttcagcctgcccgacggcgcgggcgcg
gaccccgcgttcagcaaccccatccgcttccccttcggcttcacctggccgggcaccttc
tccctgattattgaagctctccacacagattctcctgatgaccttgcaacagaaaatcca
gaaagactcatcagccgcctggccacccaaaggcacctgacggtgggtgaggagtggtcc
caggacctgcacagcagtggccgcacggacctcaagtactcctaccgctttgtgtgtgac
gagcactactacggagagggctgctcagttttctgccgcccccgggatgacgccttcggc
cacttcacctgcggagagcgtggggagaaagtgtgcaaccctggctggaaaggcctctac
tgcacagagcctatctgcctgcccggatgtgatgagcagcatggattttgtgacaggcca
ggggactgcaagtgcagagtgggctggcagggccggtactgtgacgagtgcatccgctat
ccgggctgtctccatggcacctgccagcagccctggcagtgcaactgccaggaaggctgg
ggaggccttttctgcaaccaggacctgaactactgcacacaccataaaccctgcaagaat
ggggccacctgcaccaacacaggccaggggagctacacatgctcctgccggcctggctac
acaggtgccacctgtgagcttgggattgacgagtgtgaccccagcccttgcaaaaatgga
gggagctgcacggatcttgagaacagctattcctgtacatgcccacctggcttctacggc
aaaatctgtgaattgagtgccatgacctgtgcagacggtccttgcttcaatgggggccga
tgctcagacagccctgatggagggtacagctgtcgctgccctgtgggctattccggcttc
aactgtgagaagaaaattgactactgcagttcttcaccctgttctaatggcgccaagtgt
gtggacctgggtgatgcttacctgtgccgctgccaggtcggcttctccgggaggcactgc
gacgacaatgtggacgactgtgcttcttccccgtgcgccaacgggggcacctgccgtgat
ggcgtgaatgacttctcctgcacctgcccacccggctacacgggcaggaactgcagtgcc
cccgtcagcaggtgtgagcacgcaccttgccacaatggggccacctgccacgagaggggc
caccgctacgtgtgcgagtgcgcccggggctacgggggccccaactgccagttcctgctc
cccgagctgcccccaggcccggcggtggtggacctcaccgagaagctagagggtcagggc
gggccgttcccctgggtggctgtgtgcgccggggtcatccttgtcctcatgctgctgctg
ggctgtgccgccatggtggtctgcatccggctgaggctgcagaagcgccggcccccagct
gagccctgccggggggagacagaaaccatgaacaacctggccaactgccagcgtgagaag
gacatctcagtcagcgtcattggggcaacgcagatcaagaacaccaacaagaaggcagac
ctccatggggaccacggcgctgacaagaatggcttcaaggcccgctaccccaccgtggac
tataacctggtgcaggacctcaagggcgatgaagccggcgtcagggacatgcacagcaag
cgtgacaccaagtgccagccccagggctcctcaggggaggagaaggggaatccgaccaca
ctcaggggtggagaagcatctgaaagaaaaaggccggattcagcctgttcaacttcgaaa
gacaccaagtaccagtcagtgtatgtcatatccgaggagaaggatgagtgcgtcatagca
actgaggtgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044427
Entry
101044427         CDS       T04350                                 

Gene name
DLL4
Definition
(RefSeq) delta-like protein 4
  KO
K06051  delta
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04330  Notch signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq05200  Pathways in cancer
sbq05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101044427 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101044427 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101044427 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    101044427 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101044427 (DLL4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 EGF_3 EGF_CA
Other DBs
NCBI-GeneID: 101044427
NCBI-ProteinID: XP_003935747
UniProt: A0A2K6UZX5
LinkDB
Position
Unknown
AA seq 685 aa
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFVNEHGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGSVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPSDALISKIAIQGSLAVGQNWLFDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLLGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSIPWQCTCNEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCSCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGVHCE
HSTLSCADSPCFNGGSCRERNQGASYACECPPTFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRICRCRPGFTGTYCERHISNCARNPCAHGGTCHDLENGFMCTCPAGFSGRRCEVPSS
SDACASSPCLNRATCYTDLSTDTFVCNCPYGFVGSHCEFPVSLPPSFPWVAISLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggcggcagcgtcccggagcgcctctggctgggcgctactgctgctggtggcactttgg
cagcagcgcgcggccggctcgggcgtcttccagctgcagctgcaggagttcgtcaacgag
cacggcgtactggccagtgggcggccgtgcgagcctggctgccggactttcttccgcgtc
tgccttaagcacttccaggcagtcgtctcgcccggaccctgcaccttcgggagcgtctcg
acgccggttttgggcaccaactccttcgctgtccgggacgacagtagcggcgggggacgc
aaccctctccaactgcccttcaacttcacctggccgggtaccttctcactcatcatcgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccatcagatgcactcatc
agcaagatcgccatccagggctccctagctgtgggtcagaactggttattcgatgagcaa
accagcaccctcacaaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggagacaactgctcccgcctgtgcaagaagcgcaatgaccacttcggccactacgtgtgc
cagccagatggcaacttgtcctgccttcccggttggactggggaatactgccagcagcct
atctgtcttttgggctgtcatgaacagaacggctactgcagcaagccagcagagtgcctc
tgccggccaggctggcagggccgcctctgcaatgaatgcatcccccacaatggctgtcgc
cacggcacctgcagcattccctggcaatgcacttgtaatgagggctggggaggcctgttt
tgtgaccaagatctcaactactgcacccaccactccccgtgcaagaatggggcaacgtgc
tccaacagtgggcagcgaagctatacctgcagctgtcgcccaggctacaccggtgtggac
tgtgagctggagctcagcgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaggaggatggctaccactgcctgtgtcccccaggctactatggtgtgcattgtgaa
catagcaccttgagctgtgccgactccccctgcttcaatgggggctcctgccgggagcgc
aaccagggggccagctatgcttgtgaatgccccccaacctttaccggctccaactgcgag
aagaaagtggacaggtgcaccagcaatccctgtgccaatggaggccagtgcctgaaccga
ggtccaagccgcatatgccgctgccgtcctggattcacgggcacctactgtgaacgccac
atcagcaactgtgcccgtaacccttgtgcccatggtggcacttgccacgacctggagaat
gggttcatgtgcacctgccctgctggcttctctggccggcgctgtgaggtgccgtcatcc
agcgatgcctgtgcctcgagtccctgcctcaacagggccacctgctacactgacctctcc
acagacaccttcgtgtgcaactgcccctatggctttgtgggcagccactgcgagttcccc
gtgagcttgccgcccagcttcccctgggtggccatctccctgggcgtggggctggcggtg
ctgttggtgctgctgggcatggtggcagtggctgtgcggcagctgcgacttcgacggcca
gatgatggcagcagggaggccatgaacaacttgtcggacttccagaaggacaacctgatt
cctgccgcccagcttaaaaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacagcaaaaccacacactggactataatctggccccaggg
ccactggggcgggggaccatgccaggaaagtttcctcacagtgacaagagcttaggggag
aaggcgccactgcggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaggagaggaacgaatgtgtc
attgccacggaggtataa

DBGET integrated database retrieval system