KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036519
Entry
101036519         CDS       T04350                                 

Gene name
IGF2
Definition
(RefSeq) insulin-like growth factor II isoform X1
  KO
K13769  insulin-like growth factor 2
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101036519 (IGF2)
   04014 Ras signaling pathway
    101036519 (IGF2)
   04151 PI3K-Akt signaling pathway
    101036519 (IGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036519 (IGF2)
   05205 Proteoglycans in cancer
    101036519 (IGF2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101036519 (IGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101036519 (IGF2)
   00536 Glycosaminoglycan binding proteins [BR:sbq00536]
    101036519 (IGF2)
Cytokines and growth factors [BR:sbq04052]
 Growth factors
  Growth factors (RTK binding)
   101036519 (IGF2)
Glycosaminoglycan binding proteins [BR:sbq00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101036519 (IGF2)
SSDB
Motif
Pfam: IGF2_C Insulin
Other DBs
NCBI-GeneID: 101036519
NCBI-ProteinID: XP_003943336
UniProt: A0A2K6T1W8
LinkDB
Position
Unknown
AA seq 180 aa
MGFPMGKSMLVLLTFLAFASCCIAAYRPRETLCGGELVDTLQFVCGDRGFYFSRPASRVS
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSPTVLPDNFPRYPVGKIFQYDTWK
QSTQRLRRTLPALLRNRRGRVLTKELELFKEAKRHRPLTALSTQDPTHGGTPPEMSSNQK
NT seq 543 nt   +upstreamnt  +downstreamnt
atgggattcccaatggggaagtcgatgctggtgcttctcaccttcttggccttcgcctcg
tgctgcattgctgcttaccgccccagggagaccttgtgtggcggggagctggtggacacc
ctccagttcgtctgtggggaccgcggcttctacttcagcaggcccgcaagccgtgtgagc
cgtcgcagccgtggcatcgtggaggagtgctgcttccgcagctgcgacctggccctcctg
gagacctactgtgccacccccgccaagtccgagagggacgtgtcgacctctccgaccgtg
cttccggacaacttccccagataccccgtgggcaagatcttccaatatgacacctggaag
cagtccacccagcgcctgcgcaggaccctgcctgccctcctgcgtaaccgccggggtcgc
gtgctcaccaaggagctcgagctgttcaaggaggccaagcgtcaccgtcccctgactgct
ctgtccacccaagaccccacccacgggggcacccccccagagatgtccagcaatcagaag
tga

DBGET integrated database retrieval system