KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036569
Entry
101036569         CDS       T04350                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04657  IL-17 signaling pathway
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04915  Estrogen signaling pathway
sbq04926  Relaxin signaling pathway
sbq05161  Hepatitis B
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05215  Prostate cancer
sbq05219  Bladder cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101036569 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101036569 (MMP9)
   04670 Leukocyte transendothelial migration
    101036569 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101036569 (MMP9)
   04926 Relaxin signaling pathway
    101036569 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036569 (MMP9)
   05202 Transcriptional misregulation in cancer
    101036569 (MMP9)
   05206 MicroRNAs in cancer
    101036569 (MMP9)
   05205 Proteoglycans in cancer
    101036569 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    101036569 (MMP9)
   05215 Prostate cancer
    101036569 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101036569 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101036569 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101036569 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbq01002]
    101036569 (MMP9)
Enzymes [BR:sbq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     101036569 (MMP9)
Peptidases and inhibitors [BR:sbq01002]
 Metallo peptidases
  Family M10
   101036569 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 Reprolysin_3 DUF4953
Other DBs
NCBI-GeneID: 101036569
NCBI-ProteinID: XP_003936522
UniProt: A0A2K6SPS9
LinkDB
Position
Unknown
AA seq 703 aa
MSLWQPLVLALLALGCCSAAPRRRQPTRVVFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSTTLKAMRTPRCGVPDLGKFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSQDADIVILFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTQFGNADGAACHFPFTFEGRS
YYACTTDGRSDGVPWCSTTANYDNDRRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
DCTTDGRSDGYRWCATTSNYDQDKLYGFCPTRADSTVIGGNSAGQPCVFPFTFLGKEYSS
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEEPPLHKDDVKGIQHLYGSRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSEG
PTGPPSAGPTGPPTAGPSAATTVSLDPVDNACNVNIFDAIAEIGNQLYFFKDGRYWRFFE
GRGSRPQGPFPIADRWPALPRKLDSAFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKL
GLGADVAQVTGALPRGAGKMLLFSGRRVWRFDVKAQMVDPQSASEVDRIFPGVPLDTHDV
FQYREKAYFCQDRFYWRVSSRNEVNQVDQVGYVTYDILQCPED
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtactggcactcctggcactgggctgctgctctgctgcc
ccccgacggcgccagcccacccgagtggtcttccctggagacctgagaaccaatctcact
gacaggcagctggcagaggaatatctgtaccgctatggttacactcgggtggcagagatg
cgtggggagtcgaagtctctggggcctgccctgctgcttctccagaagcaactgtccctg
cccgagaccggtgagctggacagcaccacgctgaaggccatgcggaccccacggtgcggg
gtcccagacctgggaaagtttcaaacctttgagggcgacctcaagtggcaccaccacaac
atcacttattggatccaaaactactcggaggacttgcctcgggcggtgattgacgatgcc
tttgctcgagccttcgcgctgtggagcgcggtgacgccgctcaccttcactcgtgtgtac
agtcaggacgcagacatcgtcatcctgttcggtgttgcggagcatggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttccccctggccccggcattcaggga
gacgcccatttcgacgatgaagagttgtggacgctgggcaagggtgtcgtggttccaact
cagtttggaaacgcagatggggccgcctgccacttccccttcaccttcgagggccgctcc
tactacgcctgcaccaccgacggtcgctccgacggcgtgccctggtgcagtaccacggcc
aactacgacaacgaccgccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatgcggacgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gactgcaccacggacggtcgctcggacggctaccgctggtgcgccaccacctccaactat
gaccaggacaagctctacggcttctgtccgacccgagccgattcgacagtgatcgggggc
aactcggcggggcagccgtgcgtcttccccttcaccttcctgggtaaggagtactcatct
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctactacctcgaactttgac
agcgacaagaagtggggcttctgcccagaccaaggatacagtctgttcctcgtggcggcg
cacgagttcggccacgcgctgggcttagatcactcctcagtgccagaggcgctcatgtac
cccatgtaccgcttcactgaggagccccccttgcataaggatgacgtgaaaggcatccag
cacctctatggttctcgccctgaacctgagccacggcctccgaccaccactacaccgcag
cccacggctcccccgacggtctgccccaccggaccccccactgtccgcccctcagagggc
cccacaggtcccccctcagccggccccacaggtcccccgactgctggcccttctgcggcc
actactgtgtctttggatccggtggacaatgcctgcaacgtgaacatcttcgacgccatc
gcggagattgggaaccagctgtatttcttcaaggatgggaggtactggcgattctttgag
ggcagggggagccggccgcagggccccttccccatcgctgacaggtggcccgccctgccc
cgcaagctggactcggcctttgaggagccgctctccaagaagcttttcttcttctctggg
cgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgcttggacaagctg
ggcctgggcgccgacgtggcccaggtgaccggggccctcccgcgcggcgcggggaagatg
ctgctgttcagcgggaggcgcgtctggaggttcgacgtgaaggcgcagatggtggatccc
cagagtgccagcgaggtggaccggatattccccggagtgcccttggacacgcatgacgtc
ttccagtaccgagagaaagcctatttctgccaggaccgcttctactggcgcgtgagttcc
cggaatgaggtgaaccaggtggaccaagtgggctacgtgacctatgacatcctgcagtgc
cctgaggactag

DBGET integrated database retrieval system