KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036680
Entry
101036680         CDS       T04350                                 

Gene name
SCP2
Definition
(RefSeq) non-specific lipid-transfer protein
  KO
K08764  sterol carrier protein 2 [EC:2.3.1.176]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00120  Primary bile acid biosynthesis
sbq01040  Biosynthesis of unsaturated fatty acids
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04146  Peroxisome
Module
sbq_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
sbq_M00861  beta-Oxidation, peroxisome, VLCFA
sbq_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    101036680 (SCP2)
   01040 Biosynthesis of unsaturated fatty acids
    101036680 (SCP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101036680 (SCP2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101036680 (SCP2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.176  propanoyl-CoA C-acyltransferase
     101036680 (SCP2)
SSDB
Motif
Pfam: SCP2 Thiolase_C Thiolase_N Alkyl_sulf_C ACP_syn_III SCP2_2 Ketoacyl-synt_C SpoVAD
Other DBs
NCBI-GeneID: 101036680
NCBI-ProteinID: XP_010347218
UniProt: A0A2K6U011
LinkDB
Position
Unknown
AA seq 463 aa
MTGIPIINVNNNCSTGSTALFIARQLIQGGVAECVLALGFEKMEKGGLGIKFSDRTNPLD
KHLDLLIDKYGLSSHPVAPQMFGLAGKEHIEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQ
DEYSLDEVMASKKVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQPKAVEILAQEMMT
DLPSSFEEKSMIKMVGFDMSKEAARKCYEKSGLTPSDIDVIELHDCFSANELLTYEALGL
CPEGQGGTLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGERQV
PGAKVALQHNLGLGGAVVVTLYKMGFPEAARTHQIEAVPTSSASDGFKANLVFKEIEKKL
EEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDL
LALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGKAKL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgactggaattcctataatcaatgtcaacaataactgttctactggttctactgctttg
tttatagcccgccagctgattcaaggtggtgtggcagaatgtgtcttggctcttggattt
gagaagatggagaagggaggccttggaataaaattttcagatagaaccaatcccttggat
aaacatcttgacctcctgatcgataagtatggattgtcttctcacccagttgctcctcag
atgtttgggcttgctggaaaagaacatatagaaaaatatggaacaaaaattgaacacttt
gcaaaaattggatggaaaaatcataaacattcagttaataacccgtattcccagttccaa
gatgaatacagtttagatgaagtgatggcatctaaaaaagtttttgattttttgacaatc
ttacagtgttgtcctacttcagatggtgctgcagcagcaattttggccagtgaagcattt
gtacagaagtatggcctgcaacccaaagctgtggaaattttggcacaagaaatgatgact
gatttgccaagctcgtttgaagaaaaaagcatgattaaaatggttggctttgatatgagt
aaagaagctgcaagaaaatgctatgagaaatctggcctgacaccaagtgatattgacgta
atagaacttcatgattgcttttctgccaatgaactccttacttacgaagcactaggactc
tgtccagaaggacaaggtggaacactggttgacagaggagataatacatatggaggaaag
tgggtcataaatcctagtggtggattgatttcaaagggacacccactgggagctacaggt
ctggctcagtgtgcggagctctgctggcagctgagaggggaagccggagagaggcaagtt
cctggtgcaaaggtggctctgcagcataatttaggccttggaggagctgtggttgtaaca
ctctacaagatgggttttcccgaagccgccagaactcatcaaattgaagctgttccaacc
agctctgcaagtgatggatttaaggcaaatctcgtctttaaggagattgagaagaaactt
gaagaggaaggagaacagtttgtgaagaaaatcggtggtatttttgccttcaaggtgaaa
gatggtcctgggggtaaagaggccacctgggtggtggatgtgaagaatggcaaaggatca
gtgcttcccaactcagataagaaggctgactgcacaatcacaatggctgactcagactta
ctggctttaatgactggtaaaatgaatcctcagtcggccttctttcaaggcaaattgaaa
atcactggcaacatgggtctggctatgaagttacaaaatcttcagcttcagccaggcaaa
gctaagctgtga

DBGET integrated database retrieval system