KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036684
Entry
101036684         CDS       T04350                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04114  Oocyte meiosis
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04934  Cushing syndrome
sbq05161  Hepatitis B
sbq05162  Measles
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05215  Prostate cancer
sbq05222  Small cell lung cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101036684 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101036684 (CCNE2)
   04114 Oocyte meiosis
    101036684 (CCNE2)
   04115 p53 signaling pathway
    101036684 (CCNE2)
   04218 Cellular senescence
    101036684 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036684 (CCNE2)
   05206 MicroRNAs in cancer
    101036684 (CCNE2)
   05203 Viral carcinogenesis
    101036684 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101036684 (CCNE2)
   05215 Prostate cancer
    101036684 (CCNE2)
   05222 Small cell lung cancer
    101036684 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101036684 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101036684 (CCNE2)
   05161 Hepatitis B
    101036684 (CCNE2)
   05162 Measles
    101036684 (CCNE2)
   05169 Epstein-Barr virus infection
    101036684 (CCNE2)
   05165 Human papillomavirus infection
    101036684 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbq03032]
    101036684 (CCNE2)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101036684 (CCNE2)
DNA replication proteins [BR:sbq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101036684 (CCNE2)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101036684 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101036684
NCBI-ProteinID: XP_010347691
UniProt: A0A2K6TUB0
LinkDB
Position
Unknown
AA seq 404 aa
MSRRSSRIQAKQQPQPSQTESPQDAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK
ESRYVHDKHFEVLHSDLEPQMRSVLLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILKMELIILKALKWELCP
VTVISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAVDSLEFQYRILTAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
TSYLAMLEEVNYINTFRKGGQLSPVCSGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtatacaggctaagcagcagccccagcccagccagacggaa
tccccccaagacgcccaaataatccaggccaagaagaggaagacaacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaattgttggccacct
gtattatctggggggatcagtccttgcattatcattgaaacacctcacaaagaaatagga
acaagtgatttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttcaaaggaagtctggctaaacatgttaaaaaag
gagagcagatatgttcatgacaaacattttgaagttctgcattctgacttggaaccacag
atgaggtctgtacttctagactggcttttagaggtatgtgaagtatacacactgcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatctacgctcctaaactccaagagtttgcttatgtcactgatggtgcttgcagtgaa
gaggatatcttaaagatggaactcattatattaaaggctttaaaatgggaactttgtcct
gtaacagtcatctcctggctaaatctttttctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaacattcattcaaatagctcagcttttagat
ctgtgtattctagccgttgattcattagagttccagtacagaatactgactgctgctgcc
ttgtgccattttacctccattgaagtggttaagaaagcctcaggtttggagtgggacagt
atttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtactagtcca
gtgaagctgaagacttttaagaagattcctatggaagacagacataatatccagacacat
acaagttacctggctatgctggaagaagtaaattacataaacaccttcagaaaaggggga
cagctgtcaccagtgtgcagtggaggcattatgacaccaccgaagagcaccgaaaaacca
ccaggaaaacactaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052282
Entry
101052282         CDS       T04350                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04110  Cell cycle
sbq04114  Oocyte meiosis
sbq04115  p53 signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04934  Cushing syndrome
sbq05161  Hepatitis B
sbq05162  Measles
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05206  MicroRNAs in cancer
sbq05215  Prostate cancer
sbq05222  Small cell lung cancer
sbq05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101052282 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101052282 (CCNE1)
   04114 Oocyte meiosis
    101052282 (CCNE1)
   04115 p53 signaling pathway
    101052282 (CCNE1)
   04218 Cellular senescence
    101052282 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101052282 (CCNE1)
   05206 MicroRNAs in cancer
    101052282 (CCNE1)
   05203 Viral carcinogenesis
    101052282 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101052282 (CCNE1)
   05215 Prostate cancer
    101052282 (CCNE1)
   05222 Small cell lung cancer
    101052282 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101052282 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101052282 (CCNE1)
   05161 Hepatitis B
    101052282 (CCNE1)
   05162 Measles
    101052282 (CCNE1)
   05169 Epstein-Barr virus infection
    101052282 (CCNE1)
   05165 Human papillomavirus infection
    101052282 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sbq03032]
    101052282 (CCNE1)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101052282 (CCNE1)
DNA replication proteins [BR:sbq03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101052282 (CCNE1)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101052282 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101052282
NCBI-ProteinID: XP_010346165
LinkDB
Position
Unknown
AA seq 395 aa
MKEDGGAEFSARSRKRKANVAVFLQDPDEDMAKIDRTARDQCGSQAWDNNAVCVDPCSLI
PTPDKEEDELVYPNSICKPRHIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDKHFLE
QHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISS
LFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQ
VAYLNDIHEVLLPQYPQQTFIQIAELLDLCVLDVDCLEFPYGILAASAVYHFSSSELMEK
VSGYEWCDIENCAKWMVPFAMVIRETGTSKLKHFRGVADEDAHNIQTHRDSLDLLDKARA
KKAMLSEQNRASPLPSGLLTPPQSSKKQSNGPEMA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaaggaggacggcggcgcggagttctcggctcgctccaggaagaggaaggcaaacgtg
gccgtttttttgcaggacccagatgaagacatggccaaaatcgacaggacggcgagggac
caatgtgggagccaggcttgggacaataacgcagtctgtgtggacccctgctctctaatc
cccacacctgacaaagaagaagatgagctggtttacccaaactccatatgcaagcctcgg
catatcgcaccgtccagaggttccccactgcctgtactgagctgggcaaatagagaggaa
gtctggaaaatcatgttaaacaaggaaaagacatacttaagggataagcactttcttgag
caacaccctcttctgcagccaaaaatgcgagcaattcttctggattggttaatggaggtg
tgtgaagtctacaagcttcacagggagaccttttacttggcacaagatttctttgaccgg
tatatggcgacacaagaaaatgtcgtaaaaactcttttacaacttattgggatttcatct
ttatttatagcagccaaacttgaggaaatctatcctccaaagttgcaccagtttgcgtat
gtgacagacggagcgtgttcaggagatgagattcttaccatggagttaatgattatgaag
gcccttaagtggcgtttaagtcccctgactattgtgtcctggctgaatgtgtacatgcag
gttgcatatctaaatgacatccatgaggtgctactgccacagtatccccagcaaaccttt
atacagattgcagagctgttggatctctgtgtcctggacgtcgactgcctcgaatttcct
tacggtatcctcgctgcttcggccgtgtatcatttctcttcatctgaattgatggaaaag
gtttcaggatatgaatggtgcgacatagagaactgtgccaagtggatggttccatttgcc
atggttataagggagacagggacctcaaaactgaagcacttcaggggcgtcgccgatgaa
gacgcacacaacatacagacccacagagacagcttggatttgctggacaaagcccgagcc
aagaaagccatgttgtctgaacaaaatagggcttctcctctccccagcgggcttctcacc
cctccacagagcagtaagaagcagagcaacgggccagaaatggcatga

DBGET integrated database retrieval system