KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036877
Entry
101036877         CDS       T04350                                 

Gene name
NRAS
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04137  Mitophagy - animal
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04625  C-type lectin receptor signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04714  Thermogenesis
sbq04720  Long-term potentiation
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05034  Alcoholism
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101036877 (NRAS)
   04012 ErbB signaling pathway
    101036877 (NRAS)
   04014 Ras signaling pathway
    101036877 (NRAS)
   04015 Rap1 signaling pathway
    101036877 (NRAS)
   04370 VEGF signaling pathway
    101036877 (NRAS)
   04371 Apelin signaling pathway
    101036877 (NRAS)
   04068 FoxO signaling pathway
    101036877 (NRAS)
   04072 Phospholipase D signaling pathway
    101036877 (NRAS)
   04071 Sphingolipid signaling pathway
    101036877 (NRAS)
   04151 PI3K-Akt signaling pathway
    101036877 (NRAS)
   04150 mTOR signaling pathway
    101036877 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101036877 (NRAS)
   04137 Mitophagy - animal
    101036877 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101036877 (NRAS)
   04218 Cellular senescence
    101036877 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101036877 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101036877 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101036877 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101036877 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    101036877 (NRAS)
   04660 T cell receptor signaling pathway
    101036877 (NRAS)
   04662 B cell receptor signaling pathway
    101036877 (NRAS)
   04664 Fc epsilon RI signaling pathway
    101036877 (NRAS)
   04062 Chemokine signaling pathway
    101036877 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101036877 (NRAS)
   04929 GnRH secretion
    101036877 (NRAS)
   04912 GnRH signaling pathway
    101036877 (NRAS)
   04915 Estrogen signaling pathway
    101036877 (NRAS)
   04917 Prolactin signaling pathway
    101036877 (NRAS)
   04921 Oxytocin signaling pathway
    101036877 (NRAS)
   04926 Relaxin signaling pathway
    101036877 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    101036877 (NRAS)
   04919 Thyroid hormone signaling pathway
    101036877 (NRAS)
   04916 Melanogenesis
    101036877 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101036877 (NRAS)
   04726 Serotonergic synapse
    101036877 (NRAS)
   04720 Long-term potentiation
    101036877 (NRAS)
   04730 Long-term depression
    101036877 (NRAS)
   04722 Neurotrophin signaling pathway
    101036877 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101036877 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101036877 (NRAS)
   04213 Longevity regulating pathway - multiple species
    101036877 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101036877 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036877 (NRAS)
   05206 MicroRNAs in cancer
    101036877 (NRAS)
   05205 Proteoglycans in cancer
    101036877 (NRAS)
   05203 Viral carcinogenesis
    101036877 (NRAS)
   05230 Central carbon metabolism in cancer
    101036877 (NRAS)
   05231 Choline metabolism in cancer
    101036877 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101036877 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101036877 (NRAS)
   05225 Hepatocellular carcinoma
    101036877 (NRAS)
   05226 Gastric cancer
    101036877 (NRAS)
   05214 Glioma
    101036877 (NRAS)
   05216 Thyroid cancer
    101036877 (NRAS)
   05221 Acute myeloid leukemia
    101036877 (NRAS)
   05220 Chronic myeloid leukemia
    101036877 (NRAS)
   05218 Melanoma
    101036877 (NRAS)
   05211 Renal cell carcinoma
    101036877 (NRAS)
   05219 Bladder cancer
    101036877 (NRAS)
   05215 Prostate cancer
    101036877 (NRAS)
   05213 Endometrial cancer
    101036877 (NRAS)
   05224 Breast cancer
    101036877 (NRAS)
   05223 Non-small cell lung cancer
    101036877 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101036877 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101036877 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    101036877 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101036877 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101036877 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    101036877 (NRAS)
   05161 Hepatitis B
    101036877 (NRAS)
   05160 Hepatitis C
    101036877 (NRAS)
   05163 Human cytomegalovirus infection
    101036877 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101036877 (NRAS)
   05165 Human papillomavirus infection
    101036877 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101036877 (NRAS)
   01522 Endocrine resistance
    101036877 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101036877 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101036877 (NRAS)
   04031 GTP-binding proteins [BR:sbq04031]
    101036877 (NRAS)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101036877 (NRAS)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101036877 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   101036877 (NRAS)
  Exosomal proteins of breast cancer cells
   101036877 (NRAS)
  Exosomal proteins of colorectal cancer cells
   101036877 (NRAS)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101036877 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 101036877
NCBI-ProteinID: XP_010342357
UniProt: A0A2K6SLL2
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaggtggtaatagacggtgaaacctgtctgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactccgatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaattggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggtg
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047035
Entry
101047035         CDS       T04350                                 

Gene name
KRAS
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04137  Mitophagy - animal
sbq04140  Autophagy - animal
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04540  Gap junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04625  C-type lectin receptor signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04714  Thermogenesis
sbq04720  Long-term potentiation
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05034  Alcoholism
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05212  Pancreatic cancer
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047035 (KRAS)
   04012 ErbB signaling pathway
    101047035 (KRAS)
   04014 Ras signaling pathway
    101047035 (KRAS)
   04015 Rap1 signaling pathway
    101047035 (KRAS)
   04370 VEGF signaling pathway
    101047035 (KRAS)
   04371 Apelin signaling pathway
    101047035 (KRAS)
   04068 FoxO signaling pathway
    101047035 (KRAS)
   04072 Phospholipase D signaling pathway
    101047035 (KRAS)
   04071 Sphingolipid signaling pathway
    101047035 (KRAS)
   04151 PI3K-Akt signaling pathway
    101047035 (KRAS)
   04150 mTOR signaling pathway
    101047035 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101047035 (KRAS)
   04137 Mitophagy - animal
    101047035 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101047035 (KRAS)
   04218 Cellular senescence
    101047035 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101047035 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101047035 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101047035 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101047035 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    101047035 (KRAS)
   04660 T cell receptor signaling pathway
    101047035 (KRAS)
   04662 B cell receptor signaling pathway
    101047035 (KRAS)
   04664 Fc epsilon RI signaling pathway
    101047035 (KRAS)
   04062 Chemokine signaling pathway
    101047035 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101047035 (KRAS)
   04929 GnRH secretion
    101047035 (KRAS)
   04912 GnRH signaling pathway
    101047035 (KRAS)
   04915 Estrogen signaling pathway
    101047035 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    101047035 (KRAS)
   04917 Prolactin signaling pathway
    101047035 (KRAS)
   04921 Oxytocin signaling pathway
    101047035 (KRAS)
   04926 Relaxin signaling pathway
    101047035 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    101047035 (KRAS)
   04919 Thyroid hormone signaling pathway
    101047035 (KRAS)
   04916 Melanogenesis
    101047035 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101047035 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101047035 (KRAS)
   04726 Serotonergic synapse
    101047035 (KRAS)
   04720 Long-term potentiation
    101047035 (KRAS)
   04730 Long-term depression
    101047035 (KRAS)
   04722 Neurotrophin signaling pathway
    101047035 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101047035 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101047035 (KRAS)
   04213 Longevity regulating pathway - multiple species
    101047035 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101047035 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047035 (KRAS)
   05206 MicroRNAs in cancer
    101047035 (KRAS)
   05205 Proteoglycans in cancer
    101047035 (KRAS)
   05203 Viral carcinogenesis
    101047035 (KRAS)
   05230 Central carbon metabolism in cancer
    101047035 (KRAS)
   05231 Choline metabolism in cancer
    101047035 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101047035 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047035 (KRAS)
   05212 Pancreatic cancer
    101047035 (KRAS)
   05225 Hepatocellular carcinoma
    101047035 (KRAS)
   05226 Gastric cancer
    101047035 (KRAS)
   05214 Glioma
    101047035 (KRAS)
   05216 Thyroid cancer
    101047035 (KRAS)
   05221 Acute myeloid leukemia
    101047035 (KRAS)
   05220 Chronic myeloid leukemia
    101047035 (KRAS)
   05218 Melanoma
    101047035 (KRAS)
   05211 Renal cell carcinoma
    101047035 (KRAS)
   05219 Bladder cancer
    101047035 (KRAS)
   05215 Prostate cancer
    101047035 (KRAS)
   05213 Endometrial cancer
    101047035 (KRAS)
   05224 Breast cancer
    101047035 (KRAS)
   05223 Non-small cell lung cancer
    101047035 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101047035 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101047035 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    101047035 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101047035 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047035 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    101047035 (KRAS)
   05161 Hepatitis B
    101047035 (KRAS)
   05160 Hepatitis C
    101047035 (KRAS)
   05163 Human cytomegalovirus infection
    101047035 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101047035 (KRAS)
   05165 Human papillomavirus infection
    101047035 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101047035 (KRAS)
   01522 Endocrine resistance
    101047035 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101047035 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sbq04031]
    101047035 (KRAS)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101047035 (KRAS)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101047035 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin AAA_25 CbiA
Other DBs
NCBI-GeneID: 101047035
NCBI-ProteinID: XP_010335620
UniProt: A0A2K6SVB2
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataagcttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047663
Entry
101047663         CDS       T04350                                 

Gene name
HRAS
Definition
(RefSeq) GTPase HRas isoform X2
  KO
K02833  GTPase HRas
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04137  Mitophagy - animal
sbq04140  Autophagy - animal
sbq04144  Endocytosis
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04210  Apoptosis
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04218  Cellular senescence
sbq04360  Axon guidance
sbq04370  VEGF signaling pathway
sbq04371  Apelin signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04625  C-type lectin receptor signaling pathway
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04714  Thermogenesis
sbq04720  Long-term potentiation
sbq04722  Neurotrophin signaling pathway
sbq04725  Cholinergic synapse
sbq04726  Serotonergic synapse
sbq04730  Long-term depression
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04916  Melanogenesis
sbq04917  Prolactin signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04929  GnRH secretion
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05010  Alzheimer disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05034  Alcoholism
sbq05132  Salmonella infection
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05200  Pathways in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05216  Thyroid cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05230  Central carbon metabolism in cancer
sbq05231  Choline metabolism in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047663 (HRAS)
   04012 ErbB signaling pathway
    101047663 (HRAS)
   04014 Ras signaling pathway
    101047663 (HRAS)
   04015 Rap1 signaling pathway
    101047663 (HRAS)
   04370 VEGF signaling pathway
    101047663 (HRAS)
   04371 Apelin signaling pathway
    101047663 (HRAS)
   04630 JAK-STAT signaling pathway
    101047663 (HRAS)
   04068 FoxO signaling pathway
    101047663 (HRAS)
   04072 Phospholipase D signaling pathway
    101047663 (HRAS)
   04071 Sphingolipid signaling pathway
    101047663 (HRAS)
   04151 PI3K-Akt signaling pathway
    101047663 (HRAS)
   04150 mTOR signaling pathway
    101047663 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101047663 (HRAS)
   04140 Autophagy - animal
    101047663 (HRAS)
   04137 Mitophagy - animal
    101047663 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101047663 (HRAS)
   04218 Cellular senescence
    101047663 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101047663 (HRAS)
   04540 Gap junction
    101047663 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101047663 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101047663 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101047663 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    101047663 (HRAS)
   04660 T cell receptor signaling pathway
    101047663 (HRAS)
   04662 B cell receptor signaling pathway
    101047663 (HRAS)
   04664 Fc epsilon RI signaling pathway
    101047663 (HRAS)
   04062 Chemokine signaling pathway
    101047663 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101047663 (HRAS)
   04929 GnRH secretion
    101047663 (HRAS)
   04912 GnRH signaling pathway
    101047663 (HRAS)
   04915 Estrogen signaling pathway
    101047663 (HRAS)
   04917 Prolactin signaling pathway
    101047663 (HRAS)
   04921 Oxytocin signaling pathway
    101047663 (HRAS)
   04926 Relaxin signaling pathway
    101047663 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    101047663 (HRAS)
   04919 Thyroid hormone signaling pathway
    101047663 (HRAS)
   04916 Melanogenesis
    101047663 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101047663 (HRAS)
   04726 Serotonergic synapse
    101047663 (HRAS)
   04720 Long-term potentiation
    101047663 (HRAS)
   04730 Long-term depression
    101047663 (HRAS)
   04722 Neurotrophin signaling pathway
    101047663 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101047663 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101047663 (HRAS)
   04213 Longevity regulating pathway - multiple species
    101047663 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101047663 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101047663 (HRAS)
   05206 MicroRNAs in cancer
    101047663 (HRAS)
   05205 Proteoglycans in cancer
    101047663 (HRAS)
   05203 Viral carcinogenesis
    101047663 (HRAS)
   05230 Central carbon metabolism in cancer
    101047663 (HRAS)
   05231 Choline metabolism in cancer
    101047663 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101047663 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101047663 (HRAS)
   05225 Hepatocellular carcinoma
    101047663 (HRAS)
   05226 Gastric cancer
    101047663 (HRAS)
   05214 Glioma
    101047663 (HRAS)
   05216 Thyroid cancer
    101047663 (HRAS)
   05221 Acute myeloid leukemia
    101047663 (HRAS)
   05220 Chronic myeloid leukemia
    101047663 (HRAS)
   05218 Melanoma
    101047663 (HRAS)
   05211 Renal cell carcinoma
    101047663 (HRAS)
   05219 Bladder cancer
    101047663 (HRAS)
   05215 Prostate cancer
    101047663 (HRAS)
   05213 Endometrial cancer
    101047663 (HRAS)
   05224 Breast cancer
    101047663 (HRAS)
   05223 Non-small cell lung cancer
    101047663 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101047663 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101047663 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    101047663 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101047663 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101047663 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101047663 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    101047663 (HRAS)
   05161 Hepatitis B
    101047663 (HRAS)
   05160 Hepatitis C
    101047663 (HRAS)
   05163 Human cytomegalovirus infection
    101047663 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101047663 (HRAS)
   05165 Human papillomavirus infection
    101047663 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101047663 (HRAS)
   01522 Endocrine resistance
    101047663 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101047663 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbq04147]
    101047663 (HRAS)
   04031 GTP-binding proteins [BR:sbq04031]
    101047663 (HRAS)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101047663 (HRAS)
Exosome [BR:sbq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101047663 (HRAS)
  Exosomal proteins of colorectal cancer cells
   101047663 (HRAS)
GTP-binding proteins [BR:sbq04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101047663 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA ATP_bind_1 Septin Ldh_1_N AAA_25
Other DBs
NCBI-GeneID: 101047663
NCBI-ProteinID: XP_003943372
UniProt: A0A2K6T011
LinkDB
Position
Unknown
AA seq 170 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTLWDPPGPM
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggaatataagctcgtggtggtgggtgccggtggcgtggggaagagtgccctgacc
atccagctgatccagaaccacttcgtggacgaatacgaccccactatagaggactcctac
cggaagcaagtggtcattgatggggagacatgcctgctggacatcctggacacggccggc
caggaggagtacagcgccatgagggaccagtacatgcgcaccggcgagggctttctgtgc
gtcttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggagcagatc
aagcgggtgaaggactcggacgacgtgcccatggtgctggtggggaacaagtgtgacctg
gctgcacgcaccgtggagtctcggcaggctcaggacctggcccgaagctacggcatcccc
tacatcgagacctcggccaaaacccggcagggcagccgctctggctctggctccagctcc
gggaccctctgggaccccccgggacccatgtga

DBGET integrated database retrieval system