KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036938
Entry
101036938         CDS       T04350                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq01524  Platinum drug resistance
sbq04068  FoxO signaling pathway
sbq04110  Cell cycle
sbq04115  p53 signaling pathway
sbq04120  Ubiquitin mediated proteolysis
sbq04144  Endocytosis
sbq04151  PI3K-Akt signaling pathway
sbq04218  Cellular senescence
sbq04625  C-type lectin receptor signaling pathway
sbq04919  Thyroid hormone signaling pathway
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05169  Epstein-Barr virus infection
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05203  Viral carcinogenesis
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05219  Bladder cancer
sbq05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101036938 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101036938 (MDM2)
   04151 PI3K-Akt signaling pathway
    101036938 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101036938 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    101036938 (MDM2)
   04115 p53 signaling pathway
    101036938 (MDM2)
   04218 Cellular senescence
    101036938 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101036938 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101036938 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036938 (MDM2)
   05202 Transcriptional misregulation in cancer
    101036938 (MDM2)
   05206 MicroRNAs in cancer
    101036938 (MDM2)
   05205 Proteoglycans in cancer
    101036938 (MDM2)
   05203 Viral carcinogenesis
    101036938 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    101036938 (MDM2)
   05220 Chronic myeloid leukemia
    101036938 (MDM2)
   05218 Melanoma
    101036938 (MDM2)
   05219 Bladder cancer
    101036938 (MDM2)
   05215 Prostate cancer
    101036938 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101036938 (MDM2)
   05169 Epstein-Barr virus infection
    101036938 (MDM2)
   05165 Human papillomavirus infection
    101036938 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101036938 (MDM2)
   01522 Endocrine resistance
    101036938 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbq04131]
    101036938 (MDM2)
   04121 Ubiquitin system [BR:sbq04121]
    101036938 (MDM2)
Enzymes [BR:sbq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101036938 (MDM2)
Membrane trafficking [BR:sbq04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101036938 (MDM2)
Ubiquitin system [BR:sbq04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    101036938 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB DUF1229 zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 101036938
NCBI-ProteinID: XP_003926601
UniProt: A0A2K6S797
LinkDB
Position
Unknown
AA seq 491 aa
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMNKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSESRCQFEGGSDQKDPVQELQEERPSSSHLVSRPSTSSRRRAVSETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSSDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKITVNDSKESCVEENEDKITQASQSQESEDYSQPSTSSSIIYSSQEDAKESEREETQ
DKEESMESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtacctactgatggtgctgtaaccacctcacagattcca
gcttcggaacaagaaaccctggttagaccaaagccattgcttttgaagttattaaagtct
gttggtgcacaaaaagacacttatactatgaaagaggttctattttatcttggccagtat
attatgaataaacgattatatgatgagaagcaacaacatattgtatattgttcaaatgat
cttctaggagatttgtttggtgtgccaagcttctctgtgaaagaacacaggaaaatatat
accatgatctacagaaacttggtagtagtcaatcagcaggaatcatcagactcaggtaca
tctgtgagtgagagcagatgtcagtttgaaggtgggagtgatcaaaaggaccctgtgcaa
gagctacaggaagagagaccttcatcttcacatttggtttctagaccatctacctcatct
agaaggagagcagttagtgagacagaagaaaattcagatgaattatctggtgaacgacaa
agaaaacgccacaaatctgacagtatttccctttcctttgatgaaagcctggctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatctacagggacgccatcg
aatccggatctggatgctggtgtaagtgaacattcaagtgattggttggatcaggattca
gtttcagatcagtttagtgtagaatttgaagttgaatctctcgactcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaaatgcacttcatgcaatgaaatgaatcccccgcttccgtcacattgtaac
agatgttgggcccttcgtgagaattggcttcctgaagataaagggaaagataaaggggaa
atctctgagaaagccaaactggaaaactcaacacaagctgaagagggctttgatgttcct
gattgtaaaaaaattacagtgaatgattccaaagagtcatgtgttgaggaaaatgaagat
aaaattacacaagcctcacagtcacaagaaagtgaggactattctcagccgtcaacttct
agtagcattatttatagcagccaagaagatgcgaaagagtctgaaagggaagaaacacaa
gacaaagaagaaagtatggaatctagtttgccccttaatgccattgaaccttgtgtgatt
tgtcaaggtcgacctaaaaatggttgcattgtccatggcaaaacaggacatcttatggcc
tgctttacatgtgcaaagaagctaaagaaaaggaataagccctgcccagtatgtagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system