KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036943
Entry
101036943         CDS       T04350                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1
  KO
K03099  son of sevenless
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04714  Thermogenesis
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05034  Alcoholism
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101036943 (SOS1)
   04012 ErbB signaling pathway
    101036943 (SOS1)
   04014 Ras signaling pathway
    101036943 (SOS1)
   04630 JAK-STAT signaling pathway
    101036943 (SOS1)
   04068 FoxO signaling pathway
    101036943 (SOS1)
   04072 Phospholipase D signaling pathway
    101036943 (SOS1)
   04151 PI3K-Akt signaling pathway
    101036943 (SOS1)
   04150 mTOR signaling pathway
    101036943 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101036943 (SOS1)
   04540 Gap junction
    101036943 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101036943 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101036943 (SOS1)
   04660 T cell receptor signaling pathway
    101036943 (SOS1)
   04662 B cell receptor signaling pathway
    101036943 (SOS1)
   04664 Fc epsilon RI signaling pathway
    101036943 (SOS1)
   04062 Chemokine signaling pathway
    101036943 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101036943 (SOS1)
   04912 GnRH signaling pathway
    101036943 (SOS1)
   04915 Estrogen signaling pathway
    101036943 (SOS1)
   04917 Prolactin signaling pathway
    101036943 (SOS1)
   04926 Relaxin signaling pathway
    101036943 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    101036943 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101036943 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101036943 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036943 (SOS1)
   05206 MicroRNAs in cancer
    101036943 (SOS1)
   05205 Proteoglycans in cancer
    101036943 (SOS1)
   05231 Choline metabolism in cancer
    101036943 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101036943 (SOS1)
   05225 Hepatocellular carcinoma
    101036943 (SOS1)
   05226 Gastric cancer
    101036943 (SOS1)
   05214 Glioma
    101036943 (SOS1)
   05221 Acute myeloid leukemia
    101036943 (SOS1)
   05220 Chronic myeloid leukemia
    101036943 (SOS1)
   05211 Renal cell carcinoma
    101036943 (SOS1)
   05215 Prostate cancer
    101036943 (SOS1)
   05213 Endometrial cancer
    101036943 (SOS1)
   05224 Breast cancer
    101036943 (SOS1)
   05223 Non-small cell lung cancer
    101036943 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    101036943 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101036943 (SOS1)
   05160 Hepatitis C
    101036943 (SOS1)
   05163 Human cytomegalovirus infection
    101036943 (SOS1)
   05165 Human papillomavirus infection
    101036943 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101036943 (SOS1)
   01522 Endocrine resistance
    101036943 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101036943 (SOS1)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101036943 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 101036943
NCBI-ProteinID: XP_010335784
UniProt: A0A2K6TXP4
LinkDB
Position
Unknown
AA seq 1276 aa
MLCQAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEV
LGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFH
QDVEDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLF
SANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYES
YARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELL
KQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQL
AIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQ
PRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNW
MAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAG
IPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTE
ADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEF
IGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLL
TLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEK
CIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQ
KKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELIN
FSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIE
PRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTA
SAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSNDTVFIQVTLPYGPRSASVSS
ISLTKGTDEMPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYS
MSDRTSVSDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFT
PPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHP
SMHRDGPPLLENAHSS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atgctatgccaagctcagccccgaagtgcttcggatgtagaggaacgtgttcaaaaaagt
tttcctcatccaattgataagtgggcaatagctgatgcccaatcagctattgaaaagagg
aagcgaagaaaccctttatctctcccagtagaaaaaattcatcctttactaaaggaggtc
ctaggttataaaattgaccaccaggtttctgtttacatagtagcagtcttagaatacatt
tctgcagacattttaaagctggttgggaattatgtaagaaatatacggcattatgaaatt
acaaaacaagatattaaagtggcaatgtgcgctgacaaggtattgatggatatgtttcat
caagatgtagaagatattaatatattatctttaactgatgaagagccttccacttcagga
gaacaaacttactatgatttggtaaaagcatttatggcagaaattcgacaatatataagg
gaactaaatctaattataaaagtttttagagagccttttgtctccaattcaaaattgttt
tcagctaatgatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgta
aagttactgggccatatagaagatacagtagaaatgacagatgaaggcagtccccatcca
ctagtaggaagctgctttgaagacttagcagaggaactggcatttgatccatatgaatcg
tatgctcgagatattttgcggcctggttttcatgatcgtttccttagtcagttatcgaag
ccgggggcagcactttatttgcagtcaataggcgaaggtttcaaagaagctgttcaatat
gttttacccaggctgcttctggcccctgtttaccactgtctccattattttgaacttttg
aagcagttagaagaaaaaagtgaagatcaagaagacaaggaatgtttaaaacaagcaata
acagctttgcttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaa
cgaagactgagtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaacta
gcaatcaagaaaatgaacgagattcagaagaatattgatggttgggagggaaaagacatt
ggacagtgttgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacat
gagagacacatatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcag
ccaagacttcctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgcga
aaggtacaaattaatgataaagatgacaccaatgaatacaagcatgcttttgaaataatt
ttaaaagatgaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaactgg
atggcagcattgatatctttacagtaccggagtacattggaaaggatgcttgatgtaaca
atgctacaggaagagaaagaggagcagatgaggctgcctagtgctgatgtttatagattt
gcagagcctgactctgaagagaatattatatttgaagagaacatgcagcccaaggctgga
attccaattatcaaagcaggaactgttattaaacttatagagaggcttacataccatatg
tatgcagatcccaattttgttcggacatttcttacaacatacagatccttttgcaaacct
caagaactactgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaa
gctgatcgcatagctatagagaatggagatcaacccttgagtgcagaattaaaaagattt
agaaaagaatatatacagcctgtgcaacttcgagtattaaatgtatgtcggcactgggta
gagcaccacttctatgattttgaaagagatgcagatcttttgcaacgaatggaagaattt
attggaacagtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatc
caaaggaaaaaaattgcaagagacaatggaccaggtcataatattacatttcagagttca
cctcccacagttgagtggcatataagcagacctgggcacatagagacttttgacctgctc
accttacacccaatagaaattgctcgacaactcactttacttgaatcagatctataccga
gctgtacagccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaac
tctcctaatcttctgaagatgattcgacataccaccaacctcactctatggtttgagaaa
tgtattgtagaaactgaaaatttagaagaaagagtagctgtggtgagtcgaataattgag
attctacaagtctttcaagagctgaacaactttaatggtgtccttgaagttgtcagtgcc
atgaattcatcacctgtttacagattagaccacacatttgagcaaataccaagtcgccag
aagaaaattttagaagaagctcatgaactgagtgaagatcactataagaaatatttggca
aaactcaggtctattaatccaccatgtgtgcctttctttggaatttatctcactaatatc
ttgaaaacagaagaaggcaaccctgaggtcttaaaaagacatggaaaagagcttataaac
tttagcaaaaggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcag
ccttactgtttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccaatg
ggaaatagcatggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaa
ccacgaaatcctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatct
cctggtgttcgtccatcaaacccaagaccaggtaccatgaggcatcccacacctcttcag
caggagccaaggaaaattagttacagtaggatccctgaaagtgaaacagaaagtacagca
tctgcaccaaattctccaagaacaccgttaacacctccgcctgcttctggtgcttccagt
accacagatgtttgcagtgtatttgattccgatcattcaagcccttttcactcaagcaat
gataccgtctttatccaagttacactgccctatggcccaagatctgcttccgtatcatct
ataagtttaaccaaaggcactgatgaaatgcctgtccctcctcctgttcctccacgaaga
cgaccagaatctgccccagcagaatcttcaccatctaagattatgtctaagcatttggac
agccccccagccattcctcctaggcaacccacatcaaaagcctattcaccacgatattca
atgtcagaccggacctctgtatcagatcctcctgaaagccctcccttattaccaccacga
gaacctgtgaggacacctgatgttttctcaagctcaccactacatctccaacctccccct
ttgggcaaaaaaagtgaccatggcaacgccttcttccccaatagcccctccccctttaca
ccacctcctcctcaaacaccttctcctcacggcacaagaaggcatctgccatcaccacca
ctgacacaagaagtggaccttcattccattgctgggccgcctgttcctccacgacaaagc
acttctcaacacatccctaaactccctccaaaaacttataaaagggagcacacacaccca
tccatgcacagagatggaccaccactgttggagaatgcccattcttcctga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046427
Entry
101046427         CDS       T04350                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04014  Ras signaling pathway
sbq04062  Chemokine signaling pathway
sbq04068  FoxO signaling pathway
sbq04072  Phospholipase D signaling pathway
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04510  Focal adhesion
sbq04540  Gap junction
sbq04630  JAK-STAT signaling pathway
sbq04650  Natural killer cell mediated cytotoxicity
sbq04660  T cell receptor signaling pathway
sbq04662  B cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04714  Thermogenesis
sbq04722  Neurotrophin signaling pathway
sbq04810  Regulation of actin cytoskeleton
sbq04910  Insulin signaling pathway
sbq04912  GnRH signaling pathway
sbq04915  Estrogen signaling pathway
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05034  Alcoholism
sbq05160  Hepatitis C
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05165  Human papillomavirus infection
sbq05200  Pathways in cancer
sbq05205  Proteoglycans in cancer
sbq05206  MicroRNAs in cancer
sbq05210  Colorectal cancer
sbq05211  Renal cell carcinoma
sbq05213  Endometrial cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05220  Chronic myeloid leukemia
sbq05221  Acute myeloid leukemia
sbq05223  Non-small cell lung cancer
sbq05224  Breast cancer
sbq05225  Hepatocellular carcinoma
sbq05226  Gastric cancer
sbq05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101046427 (SOS2)
   04012 ErbB signaling pathway
    101046427 (SOS2)
   04014 Ras signaling pathway
    101046427 (SOS2)
   04630 JAK-STAT signaling pathway
    101046427 (SOS2)
   04068 FoxO signaling pathway
    101046427 (SOS2)
   04072 Phospholipase D signaling pathway
    101046427 (SOS2)
   04151 PI3K-Akt signaling pathway
    101046427 (SOS2)
   04150 mTOR signaling pathway
    101046427 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101046427 (SOS2)
   04540 Gap junction
    101046427 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101046427 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101046427 (SOS2)
   04660 T cell receptor signaling pathway
    101046427 (SOS2)
   04662 B cell receptor signaling pathway
    101046427 (SOS2)
   04664 Fc epsilon RI signaling pathway
    101046427 (SOS2)
   04062 Chemokine signaling pathway
    101046427 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101046427 (SOS2)
   04912 GnRH signaling pathway
    101046427 (SOS2)
   04915 Estrogen signaling pathway
    101046427 (SOS2)
   04917 Prolactin signaling pathway
    101046427 (SOS2)
   04926 Relaxin signaling pathway
    101046427 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    101046427 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101046427 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101046427 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046427 (SOS2)
   05206 MicroRNAs in cancer
    101046427 (SOS2)
   05205 Proteoglycans in cancer
    101046427 (SOS2)
   05231 Choline metabolism in cancer
    101046427 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101046427 (SOS2)
   05225 Hepatocellular carcinoma
    101046427 (SOS2)
   05226 Gastric cancer
    101046427 (SOS2)
   05214 Glioma
    101046427 (SOS2)
   05221 Acute myeloid leukemia
    101046427 (SOS2)
   05220 Chronic myeloid leukemia
    101046427 (SOS2)
   05211 Renal cell carcinoma
    101046427 (SOS2)
   05215 Prostate cancer
    101046427 (SOS2)
   05213 Endometrial cancer
    101046427 (SOS2)
   05224 Breast cancer
    101046427 (SOS2)
   05223 Non-small cell lung cancer
    101046427 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    101046427 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101046427 (SOS2)
   05160 Hepatitis C
    101046427 (SOS2)
   05163 Human cytomegalovirus infection
    101046427 (SOS2)
   05165 Human papillomavirus infection
    101046427 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101046427 (SOS2)
   01522 Endocrine resistance
    101046427 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sbq04990]
    101046427 (SOS2)
Domain-containing proteins not elsewhere classified [BR:sbq04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101046427 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 101046427
NCBI-ProteinID: XP_010339439
LinkDB
Position
Unknown
AA seq 1185 aa
MCADKVLMDMFDQDDIGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFR
EAFLSDRKLFKPSDIEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLA
EEQAFDPYETLSQDILSPEFSEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPV
YHCWHYFELLKQLKACSEEQEDRECLNQAITALLNLQGSMDRIYKQYSPRRRPGDPVCPF
YGHQLRSKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGL
MISCKPNHGQTRLPGYSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFA
AKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIV
FEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIER
FEIPEPEPTDADRLAIEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERD
LELLERLESFISSVRGKAMKKWIESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISR
PGQFETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRH
TTNLTLWFEKCIVEAENFEERVAILSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLD
HTFEALQERKRKILDEAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDF
LKKKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRIEPDMRRFFENLNPMGSASEKEFTD
YLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCK
ISFSRIAETELESTVSAPTSPNTPSTPPVSASSDVSVFLDVDLSSSCDYQFDLKLFSLKI
ITGKSSKDCVLLCLSFSPTESFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDASNSKGNTK
SDDDPPAIPPRQPPPPKVKPRVPVPTGAFDGPLHSPPPPPPRDPLPDTPPPVPLRPPEHF
INCPVNLQPPPLGHLHRDSDWLRDISTCPNSPSTPPSTPSPRVPRRCYVLSSSQNNLAHP
PAPPVPPRQNSSPHLPKLPPKTYKRELLHPPLYRLPLLENAETPQ
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgtgtgcggataaggttttgatggacatgtttgatcaagacgacataggtttggtttct
ctctgtgaagatgaacctagttcttctggtgaattaaactactatgatcttgtcagaact
gaaatcgcggaagaaaggcagtatctacgggaattaaatatgatcataaaagtatttcga
gaagcctttctttctgatagaaagctgtttaaaccttctgatattgaaaagatttttagt
aacatttcagatatacatgaattgactgtgaaacttttaggtttgattgaagacacagtt
gaaatgactgatgaaagcagtcctcatcccttagctggcagctgttttgaagatttggca
gaagagcaagcatttgatccttatgaaacattatcacaggatattctttcaccagagttt
agtgaacatttcagtaaactgatggccagacctgcagttgctctacacttccagtccatt
gccgatggttttaaagaggcagttcgttatgtccttccacgtcttatgctggtgccagtg
tatcactgttggcactattttgaattactaaagcaattgaaagcatgtagtgaagaacaa
gaagacagagaatgtttgaaccaagctattactgctctcctgaatctccaaggtagcatg
gaccgaatttacaagcaatattcacctagacgccgacctggagatcctgtttgccctttt
tatggtcaccaattaagaagcaaacacctggctatcaaaaaaatgaatgaaattcagaaa
aatattgatggatgggaaggcaaagatattggacagtgttgtaatgaattcatcatggag
ggaccattgacaagaatcggtgctaaacatgaacgtcatatttttctatttgatggctta
atgatcagttgtaagcctaatcatggccagactcggcttccaggttatagtagtgcagaa
tataggttaaaagaaaaatttgtcatgaggaaaatacagatttgtgacaaagaagatact
tgtgagtacaagcatgcttttgagttagtatccaaagatgagaacagcataatatttgcc
gcgaagtctgctgaagaaaaaaataattggatggcagcccttatttctcttcattatcgt
agtactctagatcgaatgttagattcagtattattgaaagaagaaaatgaacaaccactg
agattaccaagtcctgaagtatatcgttttgtagtaaaagactctgaggaaaacatcgtt
tttgaagacaatttgcaaagtaggagtggaatccccattattaaaggaggaactgtggtg
aaattaattgaaaggcttacatatcatatgtatgcagatcccaattttgttcgtactttt
cttaccacatatcgttcattttgtaaaccacaggaattgctgagcttactgattgaacgc
tttgaaattccagagccagaacctactgatgcagacagattggcaatagagaaaggcgag
cagccaatcagtgcagatcttaaaagatttcgcaaggaatacgtccaaccagtacaactt
aggatcttaaatgtatttcggcattgggttgaacaccatttttatgactttgaaagagat
ttggaattacttgaaagactagaatccttcatttcaagtgtaagagggaaagctatgaag
aaatggatagagtcaattgctaagatcatcaagaggaagaagcaagctcaggcaaatgga
ataagccataatattacctttgaaagtccacctccaccaattgaatggcatatcagcaga
ccaggacagtttgaaacatttgatctcatgacacttcatccaatagaaattgcacgtcag
cttacacttttggagtctgatctctacaggaaagttcaaccttctgaacttgtagggagt
gtgtggaccaaagaagataaagaaataaattctccaaatttattaaaaatgattcgccat
accacaaatctcaccctctggtttgaaaaatgcattgtggaagcagaaaattttgaagaa
cgggtggcaatactaagtagaattatagaaattctgcaagtttttcaagatttgaataat
ttcaatggcgtattggagatagtcagtgcagtaaattcagtgtcagtatacagactagac
catacctttgaggcattgcaggaaagaaaacggaaaattttggatgaagctgtagaatta
agtcaagatcactttaaaaaatatctggtaaaacttaagtcaatcaatccaccttgtgtg
cctttttttggaatatatttaacaaatattctgaagaccgaagaagggaataatgatttt
ttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagaaaagtagctgaaatt
actggagaaattcagcagtatcagaatcagccttattgtttacggatagaaccagatatg
aggagattctttgaaaaccttaaccccatgggaagtgcatctgaaaaagagtttacagat
tatttgttcaacaagtcactagaaattgaacctcgaaactgcaaacagccacctcgattt
cctaggaaatcaactttctccttaaaatctcctggaataaggcctaacacaggccgacat
ggctctacctcaggtactttacgaggtcatccaacaccattagaaagagaaccatgtaaa
ataagctttagtcggattgctgaaactgagctggaatcaacagtgtcagcaccaacctct
ccaaatacaccgtctactccaccagtatctgcttcttcagacgttagtgtatttttagat
gtggatctcagcagctcctgtgattatcagtttgatttaaagctgttttcccttaagatc
ataactggcaagagcagtaaagattgtgtgctgctttgtttatctttttctcccacagag
tctttctttagttcatgtggtagtttacataaactaagtgaagagccactgattcctcct
ccacttcctcctcgaaaaaagtttgatcatgatgcttcaaattccaagggaaatacgaaa
tctgatgatgatcctcctgctattccaccaagacagcctcctcctccaaaggtaaaaccc
agagttcctgttcctactggtgcatttgatgggcctctgcatagtccacctccaccacca
ccaagagatcctcttcctgatacccctccaccggttccccttcggcctccagaacacttt
ataaactgtccagttaatcttcagccacctccactggggcatcttcacagagattcagac
tggctgagagacattagtacgtgcccaaattcaccaagcactcctcctagcacaccctct
ccaagggtaccacgtcgatgctatgtgctcagttctagtcagaataatcttgctcatccg
ccagctccccctgttccaccaaggcagaattcaagccctcatctgccaaaactgccacca
aagacttacaaacgggagcttttgcaccctccattgtacagactgcctttgctagaaaat
gcagaaactccccaatga

DBGET integrated database retrieval system