KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101036963
Entry
101036963         CDS       T04350                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X3
  KO
K05459  insulin-like growth factor 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01521  EGFR tyrosine kinase inhibitor resistance
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04014  Ras signaling pathway
sbq04015  Rap1 signaling pathway
sbq04066  HIF-1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04114  Oocyte meiosis
sbq04115  p53 signaling pathway
sbq04150  mTOR signaling pathway
sbq04151  PI3K-Akt signaling pathway
sbq04152  AMPK signaling pathway
sbq04211  Longevity regulating pathway
sbq04213  Longevity regulating pathway - multiple species
sbq04510  Focal adhesion
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04730  Long-term depression
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04913  Ovarian steroidogenesis
sbq04914  Progesterone-mediated oocyte maturation
sbq04935  Growth hormone synthesis, secretion and action
sbq04960  Aldosterone-regulated sodium reabsorption
sbq05200  Pathways in cancer
sbq05202  Transcriptional misregulation in cancer
sbq05205  Proteoglycans in cancer
sbq05214  Glioma
sbq05215  Prostate cancer
sbq05218  Melanoma
sbq05224  Breast cancer
sbq05410  Hypertrophic cardiomyopathy
sbq05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101036963 (IGF1)
   04014 Ras signaling pathway
    101036963 (IGF1)
   04015 Rap1 signaling pathway
    101036963 (IGF1)
   04066 HIF-1 signaling pathway
    101036963 (IGF1)
   04068 FoxO signaling pathway
    101036963 (IGF1)
   04151 PI3K-Akt signaling pathway
    101036963 (IGF1)
   04152 AMPK signaling pathway
    101036963 (IGF1)
   04150 mTOR signaling pathway
    101036963 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101036963 (IGF1)
   04115 p53 signaling pathway
    101036963 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101036963 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101036963 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101036963 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    101036963 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    101036963 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101036963 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    101036963 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101036963 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    101036963 (IGF1)
   04213 Longevity regulating pathway - multiple species
    101036963 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101036963 (IGF1)
   05202 Transcriptional misregulation in cancer
    101036963 (IGF1)
   05205 Proteoglycans in cancer
    101036963 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    101036963 (IGF1)
   05218 Melanoma
    101036963 (IGF1)
   05215 Prostate cancer
    101036963 (IGF1)
   05224 Breast cancer
    101036963 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101036963 (IGF1)
   05414 Dilated cardiomyopathy
    101036963 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101036963 (IGF1)
   01522 Endocrine resistance
    101036963 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sbq04052]
    101036963 (IGF1)
Cytokines and growth factors [BR:sbq04052]
 Growth factors
  Growth factors (RTK binding)
   101036963 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 101036963
NCBI-ProteinID: XP_003929668
UniProt: A0A2K6V5N4
LinkDB
Position
Unknown
AA seq 153 aa
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGERGFYFNKPTGYGSSSRRVPQTGIVNECCFRSCDLRRLEMYCAPLKPVKSARS
ARAQRHTDMPKTQKEVHLKNASRGSAGNRNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggctctgtgcctgctc
accttcaccagctctgccacagctggaccagagacgctctgtggggctgagctggtggat
gctctccagttcgtgtgtggagaaaggggcttttatttcaacaagcccactgggtatggc
tccagcagtcggagggtgcctcagacaggcatcgtgaatgagtgctgcttccggagctgt
gatctgaggagactggagatgtactgtgcacccctcaagcctgtcaagtcagcccgatct
gcccgtgcccagcgccacactgacatgcccaagacccagaaggaagtacatctgaagaac
gcaagtagagggagtgcaggaaacaggaactacagaatgtag

DBGET integrated database retrieval system