KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037223
Entry
101037223         CDS       T04350                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01040  Biosynthesis of unsaturated fatty acids
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101037223 (SCD5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101037223 (SCD5)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101037223 (SCD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101037223 (SCD5)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101037223 (SCD5)
Lipid biosynthesis proteins [BR:sbq01004]
 Desaturase
  First
   101037223 (SCD5)
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-GeneID: 101037223
NCBI-ProteinID: XP_003924004
UniProt: A0A2K6V2L3
LinkDB
Position
Unknown
AA seq 330 aa
MSGPAADAGKVPFCDAKEEIRPGLESSEGGGCPERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLIPKAKPLTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAVANSMAF
QNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
ADPVVRIQRKYYKISVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNVTWLVNS
AAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDF
MCWLGLATDRKRATKPMIKARKARTGDGSA
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtcaggtccggccgccgacgcggggaaggtccccttctgcgacgccaaggaggaaatc
cgtccggggctcgaaagctcggaggggggcggctgcccagagaggcccggcgcgcgcggg
cagcggcagaacatcgtctggaggaacgtcgtcctgatgagcctgctccatttgggggcc
gtgtactccctggtgctcatccccaaagccaagccgctcactctgctctgggcctacttc
tgcttcctcctgaccgctctgggtgtgacagctggtgcccatcgcttgtggagccacagg
tcctacaaggccaagctgcctctgaggatatttctggctgtcgccaattccatggctttc
cagaatgacatcttcgagtggtccagggaccaccgagtccaccacaagtactcagagacg
gacgctgacccccacaacgcccgccggggcttcttcttctcccatatcgggtggctgttt
gttcgcaagcatcgagatgtcattgagaaggggagaaagcttgacgtcaccgacctgctt
gctgatcctgtggtccggatccagagaaagtactataagatctccgtggtgctcatgtgc
tttgtggtccccacgctggtgccctggtacatctggggagagagtctgtggaattcctac
ttcttagcctccattctccgctacaccatctcactcaacgtcacctggctggtcaacagc
gctgcccacatgtatggaaaccggccctatgacaagcacatcagccctcggcagaacccg
ctcgtcactctgggtgccattggtgaaggcttccacaattaccatcacacctttcccttt
gactactctgcgagtgaatttggcttaaattttaacccaaccacctggttcattgacttc
atgtgctggctggggctggccactgaccgcaaacgggcaaccaagccgatgatcaaggcc
cggaaggccaggactggagatggcagtgcttga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101042428
Entry
101042428         CDS       T04350                                 

Gene name
SCD
Definition
(RefSeq) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01040  Biosynthesis of unsaturated fatty acids
sbq01100  Metabolic pathways
sbq01212  Fatty acid metabolism
sbq03320  PPAR signaling pathway
sbq04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101042428 (SCD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101042428 (SCD)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101042428 (SCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sbq01004]
    101042428 (SCD)
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101042428 (SCD)
Lipid biosynthesis proteins [BR:sbq01004]
 Desaturase
  First
   101042428 (SCD)
SSDB
Other DBs
NCBI-GeneID: 101042428
NCBI-ProteinID: XP_003922350
UniProt: A0A2K6UN48
LinkDB
Position
Unknown
AA seq 359 aa
MPAHLLQEEISSSYTTTTTITAPPSRVPQNGGDKLEKTPLYLEEDIRPDIKDDIYDPTYK
DKEGPRPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGLFYYFVSALGITAGVH
RLWSHRTYKARLPLRVFLIIANTMAFQNDVFEWARDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGGTLDLSDLKAEKLVMFQRRYYKPGVLLMCFILPTLVPFYFWGE
TFQHSLYVATFLRYAVVLNATWLVNSAAHLYGYRPYDKNISPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINLTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGSYKSG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgccggcccacttgctgcaggaggagatctctagctcctataccaccaccaccaccatc
acagcgcctccctccagggttccgcagaatggaggagataagttggagaagacgcccctc
tatttggaagaagacattcgccctgatataaaagatgatatatatgaccccacctacaag
gataaggaaggcccaaggcccaaggttgaatatgtctggagaaacatcatcctgatgtct
ctgctacacttgggcgccctgtatgggatcactttgattcctacctgcaagttctacacc
tggctttgggggttattctactattttgtcagtgctctgggcataacagcaggagttcat
cgcctgtggagccaccgaacttacaaagctcggctgcccctgcgggtctttctgatcatt
gccaacacaatggcattccagaatgatgtctttgaatgggctcgtgaccaccgtgcccac
cacaagttttcagaaacagatgctgaccctcataattcccgacgtggctttttcttctct
cacgtgggctggctgcttgtgcgcaaacacccagctgtcaaagagaagggcggtacactg
gacttgtctgacctaaaagctgagaaactggtgatgttccagaggaggtactacaaaccc
ggcgtgctgctgatgtgcttcatcctgcccacccttgtgcccttttatttctggggtgaa
acttttcaacacagcttgtacgttgccactttcttgcgatatgctgtagtgcttaatgcc
acctggctggtgaacagcgctgcccacctctacggatatcgtccttatgacaagaacatt
agcccccgggagaacatcctggtttcacttggagctgtgggtgagggcttccacaactac
caccactcctttccctatgactactctgccagtgagtaccgctggcacatcaacttaacc
acattcttcattgattgcatggctgccctcggtctggcctatgaccggaagaaagtctcg
aaggctgccatcttggccaggattaaaagaactggggatggaagctacaagagtggctga

DBGET integrated database retrieval system