KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037287Help
Entry
101037287         CDS       T04350                                 

Gene name
ACTB
Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04015  Rap1 signaling pathway
sbq04145  Phagosome
sbq04210  Apoptosis
sbq04390  Hippo signaling pathway
sbq04510  Focal adhesion
sbq04520  Adherens junction
sbq04530  Tight junction
sbq04611  Platelet activation
sbq04670  Leukocyte transendothelial migration
sbq04714  Thermogenesis
sbq04810  Regulation of actin cytoskeleton
sbq04919  Thyroid hormone signaling pathway
sbq04921  Oxytocin signaling pathway
sbq05100  Bacterial invasion of epithelial cells
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05164  Influenza A
sbq05205  Proteoglycans in cancer
sbq05225  Hepatocellular carcinoma
sbq05410  Hypertrophic cardiomyopathy (HCM)
sbq05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
sbq05414  Dilated cardiomyopathy (DCM)
sbq05416  Viral myocarditis
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101037287 (ACTB)
   04390 Hippo signaling pathway
    101037287 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101037287 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    101037287 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101037287 (ACTB)
   04520 Adherens junction
    101037287 (ACTB)
   04530 Tight junction
    101037287 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101037287 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101037287 (ACTB)
   04670 Leukocyte transendothelial migration
    101037287 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101037287 (ACTB)
   04919 Thyroid hormone signaling pathway
    101037287 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    101037287 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101037287 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101037287 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101037287 (ACTB)
   05410 Hypertrophic cardiomyopathy (HCM)
    101037287 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101037287 (ACTB)
   05414 Dilated cardiomyopathy (DCM)
    101037287 (ACTB)
   05416 Viral myocarditis
    101037287 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101037287 (ACTB)
   05135 Yersinia infection
    101037287 (ACTB)
   05100 Bacterial invasion of epithelial cells
    101037287 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    101037287 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sbq03021]
    101037287 (ACTB)
   03019 Messenger RNA biogenesis [BR:sbq03019]
    101037287 (ACTB)
   03036 Chromosome and associated proteins [BR:sbq03036]
    101037287 (ACTB)
   03029 Mitochondrial biogenesis [BR:sbq03029]
    101037287 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sbq04812]
    101037287 (ACTB)
   04147 Exosome [BR:sbq04147]
    101037287 (ACTB)
Transcription machinery [BR:sbq03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     101037287 (ACTB)
Messenger RNA biogenesis [BR:sbq03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101037287 (ACTB)
Chromosome and associated proteins [BR:sbq03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     101037287 (ACTB)
    NuA4 complex
     101037287 (ACTB)
  Chromatin remodeling factors
   BAF complex
    101037287 (ACTB)
   PBAF complex
    101037287 (ACTB)
   SWR1 complex
    101037287 (ACTB)
Mitochondrial biogenesis [BR:sbq03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    101037287 (ACTB)
Cytoskeleton proteins [BR:sbq04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     101037287 (ACTB)
Exosome [BR:sbq04147]
 Exosomal proteins
  Proteins found in most exosomes
   101037287 (ACTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 101037287
NCBI-ProteinID: XP_010343671
UniProt: A0A2K6UUH3
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatatcgctgcacttgttgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgctccccgggccgtcttcccctccatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggactcctatgtgggtgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccatcgagcacggcattgtcaccaactgggac
gacatggagaagatctggcaccacactttctacaacgaactgcgtgtggctcctgaggag
caccccgtgctgcttactgaggcccccctgaaccccaaggccaatcgtgagaagatgacc
cagatcatgtttgagactttcaacaccccagccatgtatgtggccatccaggccgtgctt
tccttgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc
cacactgtgcccatctatgaggggtatgccctcccccacgccatcctgcgtctggacctg
gctggccgggacctgactgactacctcatgaagattctcaccgagcgcggctacagcttc
accaccacagctgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctatgtcgct
ctggacttcgagcaggagatggctacggcagcctccagctcctccctggagaagagctat
gagctgcccgatggtcaggtcatcactattggcaacgagcggttccgctgccctgaggcg
ctcttccagccttctttcctgggcatggaatcttgtggcatccacgaaactacctttaac
tcaatcatgaaatgtgacgtggacatccgcaaagacctgtatgccaacacagtgctgtct
ggcggtaccaccatgtaccctggcatcgctgacaggatgcagaaggagatcaccgccctg
gcccccagcacgatgaagatcaagatcattgctcctcccgagcgcaagtactccgtgtgg
atcggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system