KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037444
Entry
101037444         CDS       T04350                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04015  Rap1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04114  Oocyte meiosis
sbq04218  Cellular senescence
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04714  Thermogenesis
sbq04722  Neurotrophin signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04728  Dopaminergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05014  Amyotrophic lateral sclerosis
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05205  Proteoglycans in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101037444 (MAPK14)
   04015 Rap1 signaling pathway
    101037444 (MAPK14)
   04370 VEGF signaling pathway
    101037444 (MAPK14)
   04668 TNF signaling pathway
    101037444 (MAPK14)
   04068 FoxO signaling pathway
    101037444 (MAPK14)
   04071 Sphingolipid signaling pathway
    101037444 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101037444 (MAPK14)
   04218 Cellular senescence
    101037444 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101037444 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101037444 (MAPK14)
   04620 Toll-like receptor signaling pathway
    101037444 (MAPK14)
   04621 NOD-like receptor signaling pathway
    101037444 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    101037444 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    101037444 (MAPK14)
   04660 T cell receptor signaling pathway
    101037444 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    101037444 (MAPK14)
   04659 Th17 cell differentiation
    101037444 (MAPK14)
   04657 IL-17 signaling pathway
    101037444 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    101037444 (MAPK14)
   04670 Leukocyte transendothelial migration
    101037444 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101037444 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    101037444 (MAPK14)
   04917 Prolactin signaling pathway
    101037444 (MAPK14)
   04926 Relaxin signaling pathway
    101037444 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    101037444 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101037444 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    101037444 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    101037444 (MAPK14)
   04722 Neurotrophin signaling pathway
    101037444 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101037444 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101037444 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    101037444 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101037444 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101037444 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101037444 (MAPK14)
   05020 Prion disease
    101037444 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    101037444 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101037444 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101037444 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101037444 (MAPK14)
   05135 Yersinia infection
    101037444 (MAPK14)
   05133 Pertussis
    101037444 (MAPK14)
   05152 Tuberculosis
    101037444 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101037444 (MAPK14)
   05161 Hepatitis B
    101037444 (MAPK14)
   05171 Coronavirus disease - COVID-19
    101037444 (MAPK14)
   05163 Human cytomegalovirus infection
    101037444 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101037444 (MAPK14)
   05169 Epstein-Barr virus infection
    101037444 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101037444 (MAPK14)
   05140 Leishmaniasis
    101037444 (MAPK14)
   05142 Chagas disease
    101037444 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101037444 (MAPK14)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101037444 (MAPK14)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101037444 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 101037444
NCBI-ProteinID: XP_010332380
UniProt: A0A2K6TTF9
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatttgggaggtg
cccgagcgttaccagaacctgtctccagtgggctccggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacgggattacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggaggaattcaat
gacgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacggatgaccacgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcctggattttggactggctcggcacacagatgacgaaatgaca
ggctacgtggccactaggtggtatagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggcacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcaaatgtatttattggtgccaatcccctg
gccgtcgacttgctggagaagatgcttgtattggactcagacaagagaattacagcagcc
caagccctggcacatgcctactttgctcagtaccatgatcctgatgatgaaccagtggcc
gatccttacgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagtctg
acgtatgacgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101040899
Entry
101040899         CDS       T04350                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04015  Rap1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04114  Oocyte meiosis
sbq04218  Cellular senescence
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04714  Thermogenesis
sbq04722  Neurotrophin signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04728  Dopaminergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05014  Amyotrophic lateral sclerosis
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05205  Proteoglycans in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101040899 (MAPK12)
   04015 Rap1 signaling pathway
    101040899 (MAPK12)
   04370 VEGF signaling pathway
    101040899 (MAPK12)
   04668 TNF signaling pathway
    101040899 (MAPK12)
   04068 FoxO signaling pathway
    101040899 (MAPK12)
   04071 Sphingolipid signaling pathway
    101040899 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101040899 (MAPK12)
   04218 Cellular senescence
    101040899 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101040899 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101040899 (MAPK12)
   04620 Toll-like receptor signaling pathway
    101040899 (MAPK12)
   04621 NOD-like receptor signaling pathway
    101040899 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    101040899 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    101040899 (MAPK12)
   04660 T cell receptor signaling pathway
    101040899 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    101040899 (MAPK12)
   04659 Th17 cell differentiation
    101040899 (MAPK12)
   04657 IL-17 signaling pathway
    101040899 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    101040899 (MAPK12)
   04670 Leukocyte transendothelial migration
    101040899 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101040899 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    101040899 (MAPK12)
   04917 Prolactin signaling pathway
    101040899 (MAPK12)
   04926 Relaxin signaling pathway
    101040899 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    101040899 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101040899 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    101040899 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    101040899 (MAPK12)
   04722 Neurotrophin signaling pathway
    101040899 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101040899 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101040899 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    101040899 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101040899 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101040899 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101040899 (MAPK12)
   05020 Prion disease
    101040899 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    101040899 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101040899 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101040899 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101040899 (MAPK12)
   05135 Yersinia infection
    101040899 (MAPK12)
   05133 Pertussis
    101040899 (MAPK12)
   05152 Tuberculosis
    101040899 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101040899 (MAPK12)
   05161 Hepatitis B
    101040899 (MAPK12)
   05171 Coronavirus disease - COVID-19
    101040899 (MAPK12)
   05163 Human cytomegalovirus infection
    101040899 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101040899 (MAPK12)
   05169 Epstein-Barr virus infection
    101040899 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101040899 (MAPK12)
   05140 Leishmaniasis
    101040899 (MAPK12)
   05142 Chagas disease
    101040899 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101040899 (MAPK12)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101040899 (MAPK12)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101040899 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 101040899
NCBI-ProteinID: XP_003932826
UniProt: A0A2K6SM66
LinkDB
Position
Unknown
AA seq 367 aa
MSSPPPARSGFYRQEVTKTVWEVRVVYRDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAAEALAHPYFESLHETEDEPQAQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgtagtggcttttaccgccaggaggtgaccaagacggtc
tgggaggtgcgcgtcgtgtaccgggatctgcagcccgtgggctcgggcgcctatggcgcg
gtgtgctccgcggtggacagccgcaccggcgccaaggtggccatcaagaagctgtaccgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgacgagaccctggat
gacttcacggacttttacctggtgatgccattcatgggcactgacctagggaagctcatg
aagcacgagaagctgggagaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaagtatatccacgctgccggcatcatccacagagatctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggactttggcctggccaggcaggccgacagc
gagatgactgggtatgtggtgactcggtggtaccgggcacccgaggtcatcttgaattgg
atgcgctacacacagacggtggacatctggtctgtgggctgcatcatggcagagatgatc
acaggcaagacattgttcaagggcagtgaccacctggaccagctgaaggagatcatgaag
gtgacagggacgcctccagctgagtttgtgcagcggctgcagagcgatgaggctaagaac
tacatgaagggcctccctgagttggagaagaaggattttgcctccatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggatgcggagcagcgggtg
acagcagccgaggcgctggctcacccctactttgagtccctgcatgagacggaagatgag
ccccaggcccagaagtatgatgactcctttgatgatgtggaccgcacactggatgaatgg
aagcgtgtcacatacaaagaagtgctcagcttcaagcctccccggcagctgggggccagg
gtctccaaggagacggctctgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101044137
Entry
101044137         CDS       T04350                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04015  Rap1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04114  Oocyte meiosis
sbq04218  Cellular senescence
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04714  Thermogenesis
sbq04722  Neurotrophin signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04728  Dopaminergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05014  Amyotrophic lateral sclerosis
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05205  Proteoglycans in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101044137 (MAPK13)
   04015 Rap1 signaling pathway
    101044137 (MAPK13)
   04370 VEGF signaling pathway
    101044137 (MAPK13)
   04668 TNF signaling pathway
    101044137 (MAPK13)
   04068 FoxO signaling pathway
    101044137 (MAPK13)
   04071 Sphingolipid signaling pathway
    101044137 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101044137 (MAPK13)
   04218 Cellular senescence
    101044137 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101044137 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101044137 (MAPK13)
   04620 Toll-like receptor signaling pathway
    101044137 (MAPK13)
   04621 NOD-like receptor signaling pathway
    101044137 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    101044137 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    101044137 (MAPK13)
   04660 T cell receptor signaling pathway
    101044137 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    101044137 (MAPK13)
   04659 Th17 cell differentiation
    101044137 (MAPK13)
   04657 IL-17 signaling pathway
    101044137 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    101044137 (MAPK13)
   04670 Leukocyte transendothelial migration
    101044137 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101044137 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    101044137 (MAPK13)
   04917 Prolactin signaling pathway
    101044137 (MAPK13)
   04926 Relaxin signaling pathway
    101044137 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    101044137 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101044137 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    101044137 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    101044137 (MAPK13)
   04722 Neurotrophin signaling pathway
    101044137 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101044137 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101044137 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    101044137 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101044137 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101044137 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101044137 (MAPK13)
   05020 Prion disease
    101044137 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    101044137 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101044137 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101044137 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101044137 (MAPK13)
   05135 Yersinia infection
    101044137 (MAPK13)
   05133 Pertussis
    101044137 (MAPK13)
   05152 Tuberculosis
    101044137 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101044137 (MAPK13)
   05161 Hepatitis B
    101044137 (MAPK13)
   05171 Coronavirus disease - COVID-19
    101044137 (MAPK13)
   05163 Human cytomegalovirus infection
    101044137 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101044137 (MAPK13)
   05169 Epstein-Barr virus infection
    101044137 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101044137 (MAPK13)
   05140 Leishmaniasis
    101044137 (MAPK13)
   05142 Chagas disease
    101044137 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101044137 (MAPK13)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101044137 (MAPK13)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101044137 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 101044137
NCBI-ProteinID: XP_010332505
UniProt: A0A2K6UYP8
LinkDB
Position
Unknown
AA seq 450 aa
MTRVTLSSSPPIHDSPNGSSKGSPQVAWLLSNHLEPQPEWLLVSSGDGIHLGNEHALGIP
TVPGSPLPCCGVEDAGRAPWAPLSVPAALGGPLASAACTENLKAQRPPRGGPAAISLFSP
GGCVSSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELQLLKHMQHENVIGLLDVFTPAS
SLRNFHDFYLVMPFMQSDLQKIMGMEFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGN
LAVNEDCELKILDFGLARPADVEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAE
MLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLKDKAAKSYIQALPQSPKKDFTQLFP
QASPQAVDLLEKMLELDVDKRLTAAQALAHPFFEPFRDPEEETEAQQPFDDSLEHEKLTV
DEWKQHIYKEIVNFSPIARKDSRRRSGMKL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgacccgagtgaccctctcctcctcccctcccattcatgactccccgaatggatcctcc
aagggctccccccaggttgcctggctgctgagtaaccatctggagccacagcccgagtgg
ctgctcgtgtcctcgggagatggcatccacttgggcaatgagcacgctctgggtatcccc
acagtcccgggctcacctctgccctgctgtggtgttgaagacgcggggcgggcgccgtgg
gctcccctttccgtcccggccgccctgggcgggcccctcgccagcgccgcttgtaccgag
aatctcaaggcccagcgccctccccggggcggcccagccgccatctcccttttctcaccg
ggcggctgtgtgagctcggccatcgacaagcggtcaggggagaaggtggccatcaagaag
ctgagccggcccttccagtccgagatcttcgccaagcgcgcctaccgggagctgcagctg
ctgaagcacatgcagcatgagaacgtcattgggctcctggatgtcttcaccccagcatcc
tccctgcgcaacttccacgacttctacctggtgatgcccttcatgcagtcggatctgcag
aagatcatggggatggagttcagtgaggataagatccagtacctggtgtatcagatgctc
aaaggccttaagtacatccactcagctggggtcgtgcacagggacctgaagccgggcaac
ctggctgtgaatgaggattgtgaactgaagatcctggattttgggctggcgcggcctgca
gatgtcgagatgactggctacgtggtgacccgctggtaccgggcccctgaggtgatcctc
agctggatgcactacaaccagactgtggacatctggtctgttggctgtatcatggcggag
atgctgacagggaaaactttgttcaaggggaaagattacctggaccagctgacccagatc
ctgaaagtgaccggggtaccaggcacagagttcgtgcagaagctgaaagacaaagcggcc
aaatcctacatccaggccctgccacagagccccaagaaggatttcactcagctcttccca
caggccagcccccaggccgtggacctgctggaaaagatgctggagctggacgtggacaag
cgcctgacggccgctcaggcccttgcccatcccttctttgaacccttccgggaccctgag
gaagagacagaagcccagcagccgtttgatgattccttagaacacgagaaactcacagtg
gatgaatggaagcagcacatctacaaggagattgtgaacttcagccccattgcccggaag
gactcgcggcgccggagtggcatgaagctgtag

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101052690
Entry
101052690         CDS       T04350                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq01522  Endocrine resistance
sbq04010  MAPK signaling pathway
sbq04015  Rap1 signaling pathway
sbq04068  FoxO signaling pathway
sbq04071  Sphingolipid signaling pathway
sbq04114  Oocyte meiosis
sbq04218  Cellular senescence
sbq04261  Adrenergic signaling in cardiomyocytes
sbq04370  VEGF signaling pathway
sbq04380  Osteoclast differentiation
sbq04550  Signaling pathways regulating pluripotency of stem cells
sbq04611  Platelet activation
sbq04620  Toll-like receptor signaling pathway
sbq04621  NOD-like receptor signaling pathway
sbq04622  RIG-I-like receptor signaling pathway
sbq04625  C-type lectin receptor signaling pathway
sbq04657  IL-17 signaling pathway
sbq04658  Th1 and Th2 cell differentiation
sbq04659  Th17 cell differentiation
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04670  Leukocyte transendothelial migration
sbq04714  Thermogenesis
sbq04722  Neurotrophin signaling pathway
sbq04723  Retrograde endocannabinoid signaling
sbq04728  Dopaminergic synapse
sbq04750  Inflammatory mediator regulation of TRP channels
sbq04912  GnRH signaling pathway
sbq04914  Progesterone-mediated oocyte maturation
sbq04917  Prolactin signaling pathway
sbq04926  Relaxin signaling pathway
sbq04933  AGE-RAGE signaling pathway in diabetic complications
sbq04935  Growth hormone synthesis, secretion and action
sbq05014  Amyotrophic lateral sclerosis
sbq05020  Prion disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05133  Pertussis
sbq05135  Yersinia infection
sbq05140  Leishmaniasis
sbq05142  Chagas disease
sbq05145  Toxoplasmosis
sbq05152  Tuberculosis
sbq05161  Hepatitis B
sbq05163  Human cytomegalovirus infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05171  Coronavirus disease - COVID-19
sbq05205  Proteoglycans in cancer
sbq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101052690 (MAPK11)
   04015 Rap1 signaling pathway
    101052690 (MAPK11)
   04370 VEGF signaling pathway
    101052690 (MAPK11)
   04668 TNF signaling pathway
    101052690 (MAPK11)
   04068 FoxO signaling pathway
    101052690 (MAPK11)
   04071 Sphingolipid signaling pathway
    101052690 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101052690 (MAPK11)
   04218 Cellular senescence
    101052690 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101052690 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101052690 (MAPK11)
   04620 Toll-like receptor signaling pathway
    101052690 (MAPK11)
   04621 NOD-like receptor signaling pathway
    101052690 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    101052690 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    101052690 (MAPK11)
   04660 T cell receptor signaling pathway
    101052690 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    101052690 (MAPK11)
   04659 Th17 cell differentiation
    101052690 (MAPK11)
   04657 IL-17 signaling pathway
    101052690 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    101052690 (MAPK11)
   04670 Leukocyte transendothelial migration
    101052690 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101052690 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    101052690 (MAPK11)
   04917 Prolactin signaling pathway
    101052690 (MAPK11)
   04926 Relaxin signaling pathway
    101052690 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    101052690 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101052690 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    101052690 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    101052690 (MAPK11)
   04722 Neurotrophin signaling pathway
    101052690 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101052690 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101052690 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    101052690 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101052690 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101052690 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101052690 (MAPK11)
   05020 Prion disease
    101052690 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    101052690 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101052690 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101052690 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101052690 (MAPK11)
   05135 Yersinia infection
    101052690 (MAPK11)
   05133 Pertussis
    101052690 (MAPK11)
   05152 Tuberculosis
    101052690 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101052690 (MAPK11)
   05161 Hepatitis B
    101052690 (MAPK11)
   05171 Coronavirus disease - COVID-19
    101052690 (MAPK11)
   05163 Human cytomegalovirus infection
    101052690 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101052690 (MAPK11)
   05169 Epstein-Barr virus infection
    101052690 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101052690 (MAPK11)
   05140 Leishmaniasis
    101052690 (MAPK11)
   05142 Chagas disease
    101052690 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101052690 (MAPK11)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101052690 (MAPK11)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101052690 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 101052690
NCBI-ProteinID: XP_010341869
UniProt: A0A2K6V0I5
LinkDB
Position
Unknown
AA seq 372 aa
MAVQPQGSFPASAEAQGRRPSWGGGAVAEKPHGHIPTAERRRPGTRASAYDSRLRQKVAV
KKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGAD
LNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLA
RQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQL
KRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFHGANPLAIDLLGRMLVLD
SDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPE
PPKPPGSLEIEQ
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcggtccagccccaggggtccttcccagcaagcgcggaggcccaagggcggaggccg
agctggggcggcggggccgtggcggaaaagccccacggccacatccccacggcggagcgg
cgccgcccgggtacacgcgcttcggcctacgactcgcggctgcgccagaaggtggcggtg
aagaagctgtcgcgccccttccagtcgctgatccacgcgcgcaggacgtaccgggagctg
cggctgctcaagcacctgaagcacgagaacgtcattgggcttctggatgtcttcacgccg
gccacgtccatcgaggacttcagcgaagtgtacttggtgaccaccctgatgggcgctgac
ctgaacaacatcgtcaagtgccaggcgctgagcgacgagcacgttcagttcctggtttac
cagctgctgcgcgggctgaagtacatccactcggccgggatcatccaccgggacctgaag
cccagcaacgtagccgtgaacgaggactgtgagctcaggatcctggacttcgggctggcc
cgccaggcagacgaagagatgacgggctacgtggccacgcgttggtaccgggcccctgaa
atcatgctcaactggatgcattacaaccagacagtggacatctggtccgtgggctgcatc
atggctgagctactccagggcaaggccctcttcccaggaagcgactacattgaccagctg
aagcgcatcatggaagtggtgggcacacccagccccgaggtgctggcaaagatctcctca
gaacatgcccggacgtacatccagtccttgccccccatgccccagaaggacctgagcagc
atcttccacggagccaaccccctggccatagacctccttggaaggatgctggtgctggat
agtgaccagagggtcagtgcggccgaggcgctggcccacgcctacttcagccagtaccac
gaccctgaggatgagccagaggccgagccgtacgatgagagcgttgaggccaaggaacgc
accgtggaggagtggaaggagctcacctaccaggaagtcctcagcttcaagcccccagag
ccaccgaagcctcctggcagcctggagattgagcagtga

DBGET integrated database retrieval system