KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037589
Entry
101037589         CDS       T04350                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04620  Toll-like receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04912  GnRH signaling pathway
sbq04926  Relaxin signaling pathway
sbq04935  Growth hormone synthesis, secretion and action
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05142  Chagas disease
sbq05161  Hepatitis B
sbq05166  Human T-cell leukemia virus 1 infection
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101037589 (MAP2K4)
   04012 ErbB signaling pathway
    101037589 (MAP2K4)
   04668 TNF signaling pathway
    101037589 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101037589 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    101037589 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101037589 (MAP2K4)
   04926 Relaxin signaling pathway
    101037589 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    101037589 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101037589 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101037589 (MAP2K4)
   05135 Yersinia infection
    101037589 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101037589 (MAP2K4)
   05161 Hepatitis B
    101037589 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101037589 (MAP2K4)
   05169 Epstein-Barr virus infection
    101037589 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101037589 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101037589 (MAP2K4)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101037589 (MAP2K4)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE7 family
   101037589 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101037589
NCBI-ProteinID: XP_010338314
LinkDB
Position
Unknown
AA seq 509 aa
MFIRPGLGDILQSARHKEENSAPRARSPDPRRLLAPQVAHPETGGSCTQFSIWRGLRLGL
GAGACPEACPGRLEPDRRADLGLRGPLGTCVLKLLQGFRALAGMAVGGRAAQSCATCKGI
HCGVSGWVFPKRDCFRLHFDNFFLASFAGKRKALKLNFANPPFKSTARFTLNPNPTGVQN
PHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAV
KRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYK
YVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGI
SGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKW
NSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMY
EERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtttataagacctggacttggagatattttgcagtcagctaggcacaaggaggagaat
tctgccccgcgggcccgcagccctgatccaagacggctgctggctccccaggtcgcgcac
cccgagacgggcgggtcctgcacgcagttcagcatctggcgcgggctgcgcctcgggctc
ggggcgggggcgtgtccagaggcgtgtccggggcgtctggaaccggaccgccgagctgac
ctcgggctccgcgggcctctgggaacctgcgttttgaaacttttgcagggtttccgtgcg
ctggcagggatggcggtgggggggcgagcggctcagtcctgtgccacctgtaagggaata
cactgtggtgtcagtgggtgggtgttccctaaaagggattgcttcagattgcattttgat
aatttcttcctggcttctttcgcaggtaaacgcaaagcactgaagttgaattttgcaaat
ccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagttcaaaac
ccacacatagagagactgagaacacacagcattgagtcatcaggaaaactgaagatctcc
cctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaattggacga
ggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatggcagtt
aaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggatttggac
gtagtaatgcggagtagcgattgcccatacattgttcagttttatggtgcactcttcaga
gagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttacaaa
tatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcacttta
gcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacagagatatc
aaaccttccaatattcttctggacagaagtggaaatattaagctctgtgattttggcatc
agtggacagcttgtggactctattgccaagacaagagatgctggctgtcggccatacatg
gcacctgaaagaatagacccaagtgcatcacgacaaggatatgatgtccgctctgatgtc
tggagtttggggatcacattgtatgagttggccacgggccgatttccttatccaaagtgg
aatagtgtatttgatcaactaacacaagtcgtgaaaggagatcctccgcagctgagtaat
tctgaggaaagggaattctccccaagtttcatcaactttgtcaacttgtgccttacgaag
gatgaatccaaaaggccaaagtataaagagcttctgaaacatccctttattctgatgtat
gaagaacgtaccgttgaggtcgcatgctatgtttgtaaaatcctggatcaaatgccagct
actcccagctctcccatgtatgtcgattga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101047840
Entry
101047840         CDS       T04350                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X1
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04010  MAPK signaling pathway
sbq04012  ErbB signaling pathway
sbq04141  Protein processing in endoplasmic reticulum
sbq04380  Osteoclast differentiation
sbq04530  Tight junction
sbq04620  Toll-like receptor signaling pathway
sbq04660  T cell receptor signaling pathway
sbq04664  Fc epsilon RI signaling pathway
sbq04668  TNF signaling pathway
sbq04722  Neurotrophin signaling pathway
sbq04912  GnRH signaling pathway
sbq04926  Relaxin signaling pathway
sbq05010  Alzheimer disease
sbq05016  Huntington disease
sbq05022  Pathways of neurodegeneration - multiple diseases
sbq05132  Salmonella infection
sbq05135  Yersinia infection
sbq05161  Hepatitis B
sbq05167  Kaposi sarcoma-associated herpesvirus infection
sbq05169  Epstein-Barr virus infection
sbq05170  Human immunodeficiency virus 1 infection
sbq05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101047840 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101047840 (MAP2K7)
   04012 ErbB signaling pathway
    101047840 (MAP2K7)
   04668 TNF signaling pathway
    101047840 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101047840 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101047840 (MAP2K7)
   04660 T cell receptor signaling pathway
    101047840 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    101047840 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101047840 (MAP2K7)
   04926 Relaxin signaling pathway
    101047840 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101047840 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101047840 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101047840 (MAP2K7)
   05016 Huntington disease
    101047840 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    101047840 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101047840 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101047840 (MAP2K7)
   05135 Yersinia infection
    101047840 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101047840 (MAP2K7)
   05161 Hepatitis B
    101047840 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101047840 (MAP2K7)
   05169 Epstein-Barr virus infection
    101047840 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101047840 (MAP2K7)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101047840 (MAP2K7)
Protein kinases [BR:sbq01001]
 Serine/threonine kinases: STE group
  STE7 family
   101047840 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 101047840
NCBI-ProteinID: XP_010347874
LinkDB
Position
Unknown
AA seq 479 aa
MPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGE
MGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGT
FITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALFYLKEKHGVIHRDVK
PSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADV
WSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDH
RKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSSVLSQPHLPFFRSSCGGL
WGLLEGRMAGPRAQTGPRPGCLVLFNFIFCFPSVCLPALTLFSVNWGALGESLASLPLSQ
DLPLCHQPSLWIRQRADRVGRGLGAAQVSPPASGPLLRLPVLPCPFLKQNALLCKPLGA
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgccccccgcccggccccgtcacatgttggggctcccgtcaaccctgttcacgccccgc
agcatggagagcattgagattgaccagaagctgcaggagatcatgaagcagacgggctac
ctgaccatcggaggccagcgctaccaggcagaaatcaatgacctggagaacttgggcgag
atgggcagcggcacctgtggccaggtgtggaagatgcgcttccggaagacgggccatgtc
attgccgtcaagcaaatgcggcgctcggggaacaaggaggagaacaagcgcatcctcatg
gacctggacgtggtgctcaagagccatgactgcccctacatcgtgcagtgcttcggaacc
ttcatcaccaacacagacgtcttcattgccatggagctcatgggcacctgtgctgagaag
ctcaagaagcggatgcagggccccatccccgagcgcatcctgggcaagatgacagtggcg
atcgtgaaggcgctgttctacctgaaggagaagcatggcgtcatccaccgagatgtcaag
ccctccaacatcctgctggatgagcggggtcagatcaagctctgcgacttcggcatcagc
ggccgcctggtggactccaaagccaagactcggagcgcgggctgtgccgcctacatggcc
cctgagcgcatcgaccccccagaccccaccaagccggactatgacatccgggcggatgtg
tggagcctgggcatctcattggtggagctggcaacgggacagtttccctacaagaactgc
aagacagactttgaggtcctcaccaaagtcctgcaggaggagcccccgcttctgcctgga
cacatgggcttctcaggggactttcaatccttcgtcaaagactgccttactaaagatcac
aggaagagaccaaagtataataagctacttgaacacagcttcatcaaacgctatgagacg
ctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaagactgagtcaccgcgg
actagcagcgtcctgagccagccgcacctgcccttcttcaggtccagctgtgggggcctc
tggggattgctggaaggtcgcatggctggtcccagggcccagacaggcccaagaccaggc
tgcctggttttatttaactttattttctgtttcccgagtgtgtgtctgcccgccctcacc
ctcttcagtgttaattggggagccctgggggagtctcttgcttccctgcctctctcccaa
gacctccccctttgtcaccagccatccctctggatcaggcagagggcggaccgggtgggc
agaggcctgggggcggctcaggtcagcccaccagccagcggacccctcctcaggctgcca
gtgttgccctgcccctttttaaaacaaaatgccctcctttgtaaacccttaggcgcttga

DBGET integrated database retrieval system