KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037790
Entry
101037790         CDS       T04350                                 

Definition
(RefSeq) 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.14.139]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00120  Primary bile acid biosynthesis
sbq01100  Metabolic pathways
sbq03320  PPAR signaling pathway
Module
sbq_M00104  Bile acid biosynthesis, cholesterol => cholate/chenodeoxycholate
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    101037790
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101037790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbq00199]
    101037790
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     101037790
Cytochrome P450 [BR:sbq00199]
 Cytochrome P450, animal type
  CYP8 family
   101037790
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 101037790
NCBI-ProteinID: XP_003926256
LinkDB
Position
Unknown
AA seq 501 aa
MVLWGPVLGALLVVIVVYLCLPGILRQRRPWEPPLDKGTVPWLGHAMAFRKNMFEFLKRM
RTKHGDVFTVQLGGQYFTFVMDPLSFGPILKDARRKLDFVEYAKKLVLKVFGYRSVQGDN
EMIHSASTKHLMGDGLKDLNEVMLDSLSFVMLKSKGRSLDASCWHEDSLFDFCYYILFTA
GYLSLFGYTKDKEQDLLQAGRLFKEFRKFDLLFPRFVYSLLWPREWLEVGRLQRLFHKML
SVKHSQEKDGISNWLCNMLQFLREQGVPSAMQDKFNFMMLWASQGNTGPASFWTLLFLLK
HQEAIQAVREEAIRVLGEARLETKQPFAFKLSALQHTPVLDSVVEETLRLRAAPTLLRMV
HEDYTLKMASGQEYLIRHGDTLALFPYLSVHLDPDIHPEPTVFKYDRFLNPDGSRKVDFF
KAGKKTHHYTMPWGSGVSICPGRFFALSEVKLFILLMVTHFDLELVDPDAPVPQVDPRRW
GFGMMQPSHDVRFRHRLHPTA
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggtgctctggggtccggtgctgggagctctgctggtggtcattgtagtatacctgtgc
ctgccagggatacttcgacaacgcaggccctgggaaccccctctggacaagggcaccgtg
ccctggcttggccatgccatggctttccggaagaatatgtttgaatttctgaagcgcatg
aggaccaagcatggagatgtgttcacagtgcagctagggggccagtacttcaccttcgtc
atggaccccctctcttttggccccatcctcaaggatgcacggagaaaactagactttgtt
gaatatgcaaaaaaactggtgctgaaggtatttggataccgttcagtgcaaggggacaac
gagatgatacactcagccagtaccaagcatctgatgggggatggcttgaaggatcttaat
gaggtcatgctggacagcctgtcctttgtaatgctgaagtccaaaggccggagtctggat
gccagttgctggcatgaggacagcctctttgacttctgctattacatcttgttcacagct
ggctacctgagcttgttcggctacacgaaggacaaggagcaggacctgctacaggcagga
aggttattcaaggagttccgaaagtttgaccttcttttccccaggtttgtctactccctg
ctgtggcctcgggagtggctagaagtgggccgactccagcgtctctttcacaagatgctc
tctgtgaaacacagccaggagaaggatggcatcagcaactggctgtgcaacatgcttcag
tttctgagggagcagggagtcccctcagctatgcaggacaagttcaacttcatgatgctc
tgggcctcccagggaaacacagggcctgcctctttctggaccctcttgttcctcctgaaa
caccaagaagccattcaggctgtgagggaggaagccatccgggtcctgggtgaggccagg
ctggagaccaagcagccctttgccttcaaactcagtgccctgcaacacaccccagtcctg
gacagtgtggtggaggagacgctccggctgagggctgcacccaccctcctcaggatggtt
catgaagactataccctgaagatggccagtgggcaggaatatctgatccgccatggagat
accctggccctctttccctacctctccgtgcacttggaccctgacatccaccctgagccc
actgtcttcaagtacgatcgcttcctcaaccctgatggcagccggaaggtggacttcttc
aaggcaggcaagaagacccaccactacaccatgccctggggttcgggcgtttccatctgc
cctgggaggttcttcgcactcagtgaggtgaagctctttatcctgcttatggtcacacac
tttgacttagagttggtggaccctgatgcaccagtgccccaggtggacccgaggcgctgg
ggttttggcatgatgcagcccagccatgatgtgcgcttccgccaccgcctgcatcccaca
gcgtga

DBGET integrated database retrieval system