KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037811
Entry
101037811         CDS       T04350                                 

Gene name
CCDC6
Definition
(RefSeq) coiled-coil domain-containing protein 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101037811 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101037811 (CCDC6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 101037811
NCBI-ProteinID: XP_003928750
UniProt: A0A2K6UQR4
LinkDB
Position
Unknown
AA seq 474 aa
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSVHPSSQP
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggcggacagcgccagcgagagcgacacggacggggcggggggcaacagcagcagctcg
gccgccatgcagtcgtcctgctcgtcgacctcgggcggcggcggtggcggcgggggaggc
ggcggcggtgggaaatcggggggcattgtcatctcgccgttccgcctggaggagctcacc
aaccgcctggcctcgctgcagcaagagaacaaggtgctgaagatagagctggagacctac
aaactgaagtgcaaggcactgcaggaggagaaccgcgacctgcgcaaagccagcgtgacc
atccaagccagggctgagcaggaagaagaattcattagtaacactttattcaagaaaatt
caggctttgcagaaggagaaagaaacccttgctgtaaattatgagaaggaagaagagttc
cttactaatgagctctccagaaaattgatgcagttgcagcatgagaaagccgaactagaa
cagcatcttgaacaagaacaggaatttcaggtcaacaaactgatgaagaaaattaaaaaa
ctggagaatgacaccatttctaagcaacttacattagaacagttgagacgggagaagatt
gaccttgaaaatacattggaacaagaacaagaagccctggtcaatcgcctctggaaaagg
atggataagcttgaagctgaaaagcgaatcctgcaggaaaaattagaccagcctgtctct
gctcccccatcgcctagagatatctccatggagattgattctccagaaaatatgatgcgt
cacatcaggtttttaaagaatgaagtggaacgactgaagaagcaactgagagctgctcaa
ttacagcattcagagaaaatggcacagtatctggaggaggaacgtcacatgagggaagag
aacttgaggctgcagaggaagctacagagggagatggagagaagagaagccctctgtcga
cagctctccgagagtgagtccagcttagaaatggatgacgaaaggtattttaatgagatg
tctgcacaaggattaagacctcgcactgtgtccagcccgatcccttacacgccttctccg
agttcaagcaggcctatatcacctggtctatcatatgcaagtcacacagttggtttcacg
ccaccaacttcactgactagagccggaatgtcttactacaattccccgggtcttcatgtg
cagcacatgggaacatcccatggtatcacaaggccttcaccacggagaagcaacagtcct
gacaaattcaaacggcccacgccgcctccatctcccaacacacagaccccagtccagcca
cctccgcctccacccccaccacccatgcagcccacggtcccctccgcagccacctcgcag
cccactccttcgcaacattcggtgcacccctcctcccagccttaa

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101046425
Entry
101046425         CDS       T04350                                 

Gene name
NCOA4
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq04216  Ferroptosis
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101046425 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101046425 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101046425 (NCOA4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 101046425
NCBI-ProteinID: XP_010338907
LinkDB
Position
Unknown
AA seq 621 aa
MNTFQDKSGSSSNREPLLRCSDAQRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEXVDLIYQLKEETLQQQAQQLYWLLGQFNCLTHQLECTQNKDLANQVSV
CLERLGSLTLKPEDSTVLLFEADTTALRQTITTFGSLKTIQIPEHLMAHASSSNIGPFLE
KRGYIPMPEQKSASSIAAVPLSEWLLGSKPASGHKSPYISSTNPQDWLTQKQTLENSQTS
SGACNFFSNVWGNLKDLENWLLESQQQEVPEKPSYQKCNSHSTASSFSTEMEKVEDLELP
DQDKMDLSDWLVTPQESHKLGKPENGSHEISEKFKLLFQSYNVNDWLVKTDSCTNCQGNQ
PKGVEIENLGNLKCLNDHLEAXKPLSTPSVVTEDWLVQNCQDPCKVEEVCRANEPCTSFA
ECVCDENFEKEALYKWLLKKEGKDKNGMPMEPKPEPEKHKDSLNMWLCPSRKEVIEQPKA
PKAMVPSRIADSFQVIKNSPLSEWLIRPLYKEGSPKEVPSTEDRAGKQKLKSAMSTFWCP
FNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHKFPPDHYGLPAVCDL
FACMQLKVDKEKWLYRTPLQM
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgaataccttccaagacaagagtggcagctccagtaatagagaaccccttttgagatgt
agtgatgcacagagggacttggaacttgctattggtggagttctccgggctgagcagcaa
attaaagataacttgcgagaggtcaaagctcagattcacagttgcataagccgtcacctg
gaatgtcttagaagccgtgaggtgtggctatacgaataggtggacctcatctatcagctt
aaagaggagacacttcagcagcaagctcagcagctgtactggttactgggccagttcaat
tgtcttactcatcagctggagtgtacccaaaacaaagatctagccaatcaagtctctgtg
tgcctggagagactgggcagtttgacccttaagcctgaagattcaactgtcctgctcttt
gaagccgacacaactgctctgcgccagaccatcaccacctttgggtctctcaaaaccatt
caaattcctgagcacttgatggctcatgctagttcatcaaatattgggcctttcctggag
aagagaggctatatcccaatgccagagcagaagtcagcatccagtattgcagctgtccct
ctcagcgaatggctccttggaagcaaacctgccagtggtcataagtctccttacatatcc
agcaccaacccccaggactggctcacccaaaagcagaccttggagaatagtcagacttct
tctggagcctgcaatttcttcagtaatgtctggggaaacctaaaggacttagaaaactgg
cttctcgagagtcagcaacaggaagttcctgaaaaaccaagttatcaaaagtgtaacagc
cattccactgctagttctttctccactgaaatggaaaaggttgaagatctagagcttcct
gatcaagataagatggacttatcagattggctggtgactccccaggaatcccataagctg
gggaagcctgagaatggcagtcatgaaatcagtgagaagtttaagctcttgttccagtcc
tataatgtgaatgattggcttgtcaagactgactcctgtaccaactgtcagggaaaccag
cccaaaggtgtggagattgaaaacctgggcaatctgaagtgcctgaatgaccacttggag
gcctagaaaccattgtccacccccagcgtggttacagaggattggcttgtccagaactgt
caggacccatgtaaggtagaggaggtgtgcagagccaatgagccctgcacaagctttgca
gagtgtgtgtgtgatgagaattttgagaaggaggctctgtataaatggcttctgaagaaa
gaaggaaaggataaaaatgggatgcccatggaacccaaacctgagcctgagaagcataaa
gattccctgaatatgtggctttgtccttctagaaaagaagtaatagaacaacctaaagca
ccaaaggcaatggttccttctagaattgctgattccttccaagtcataaagaacagcccc
ttgtcggagtggcttatcaggcccctatacaaagaaggaagtcccaaggaagtgcctagt
actgaagacagagctggcaaacaaaagcttaaaagcgccatgagtactttctggtgtccc
tttaatacagcagactgggtcctgccaggaaaaaagatgggcaacctcagccagttatcc
tctggagaagacaagtggctgcttcgaaagaaggcccaggaagtattacttaattcacct
ctacaggaggaacataagttccccccagaccattacggcctccctgcggtttgtgatctc
tttgcctgtatgcagcttaaagttgataaagagaagtggttatatcgaactccactacag
atgtga

KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101053966
Entry
101053966         CDS       T04350                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq05200  Pathways in cancer
sbq05216  Thyroid cancer
sbq05223  Non-small cell lung cancer
sbq05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101053966 (RET)
   05230 Central carbon metabolism in cancer
    101053966 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101053966 (RET)
   05223 Non-small cell lung cancer
    101053966 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbq01001]
    101053966 (RET)
Enzymes [BR:sbq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101053966 (RET)
Protein kinases [BR:sbq01001]
 Receptor tyrosine kinases (RTK)
  RET family
   101053966 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 101053966
NCBI-ProteinID: XP_003930063
LinkDB
Position
Unknown
AA seq 1135 aa
MRTFSEDLDSEDALSTNILEAVVHKKGLPRNHPDLDNSIEMQEVPPHWAALGHLDWWLVW
LQAARTAAPFAAQKPYPHHPSLTSLLPTVALGLYFSRDAYWENLYVDQPAGMPLLYVHAL
RDTPGEVPSFHLGRHLYGTYHTRLHENNWIRIQEDTGLLYLNRSLDQRTWKKLSVRNGGF
RVFTVYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPQELCFPEKSLYFRI
RENRPPGTFHQFRLLPVQFLCPNISVTYRLLEGEGLPFRCASDSLEVSTRWALDREQREK
YQLVAVCTVRAGAREEVEMVPFLVSVYDEDDSAPTFPAGVDTASALVEFKRKKDTVVATL
RVFDADVVPASGELVRRYTSTLLPRDTWAQQTFRVEHWPNETLVQANGSFVRATVHDYRL
VLNRNLSIAENRTMQLAVLVNDSDFQGPGAGVVLLHFNVSVLPISLHLPSTSFSVSRRAH
RFAQIGKVCVENCQAFSGINVQYELHASGANCSTLGVVTSAADTSGILFVNDTKALRRPK
CAELQYMVVATDQQTCRQAQAQLLVTVVGSYITEEVGCPLSCAVSKRRLECEECGGLGAL
TGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVEAQDINICPQDCLRVSIVGGHEPG
EPRGIKAGYGTCNCFPEEKKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCI
HRYHKFAHKPPVSSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKW
EFPRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFN
LLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYVGSGGSRNSSS
LDHPDERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSR
DVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPP
ERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLD
LAASTPSDSLLYDDGLSEEEMPLVDCNNAPLPRALPSTWIENKLYGRISHAFTRF
NT seq 3408 nt   +upstreamnt  +downstreamnt
atgaggacattctcagaagacctggactctgaggacgcattgagcacaaacatcctggaa
gccgtggtgcataagaaggggctgcccaggaaccaccctgacctggataacagcatcgag
atgcaggaggtgcccccacattgggctgccctggggcatctggattggtggcttgtctgg
ctccaggctgccaggacagccgctccttttgctgctcaaaagccttatcctcaccatcct
tcactcacttccctacttcccacagtggccctaggcctctacttctcaagggatgcttac
tgggagaatctgtacgtggaccagccggccggcatgcccttgctctacgtgcatgccctg
cgggacactcctggggaggtgcccagcttccacctgggccggcacctctatggcacatac
cacacccggctgcacgagaacaactggatccgcattcaggaagacaccggcctcctctac
cttaaccggagcctggaccagagaacctggaagaagctcagtgtccgcaacggaggtttc
cgggtgttcaccgtctacctcaaggtcttcctgtcacccacgtcccttcgtgagggcgag
tgccagtggccaggctgtgcccgagtgtacttctccttcttcaacacctcctttccggcc
tgcagctccctcaagccccaggagctctgcttcccagagaaaagcctctacttccgcatt
cgtgagaaccggcccccaggcaccttccaccagttccgcctgctgcctgtgcagttcttg
tgccccaacatcagcgtgacctacaggctcctggagggtgagggtctgcccttccgctgc
gcttcggacagcctggaggtgagcacgcgctgggccctggaccgcgagcagcgggagaag
taccagctggtggccgtgtgcaccgtgcgcgccggtgcgcgcgaggaggtggagatggtg
cccttcctggtgagcgtgtacgacgaggacgactcggcgcccaccttccccgcgggcgtc
gacaccgccagcgccttggtggagttcaagcggaagaaggacaccgtggtggccacactg
cgtgtctttgatgcggacgtggtgcctgcatcgggggagctggtgagacggtacacaagc
acgctgctccccagggatacctgggcccagcagaccttccgggtggaacactggcccaac
gagaccttggtccaggctaacggcagcttcgtgcgggcgaccgtgcacgactataggctg
gttctcaaccggaacctctccatcgcggagaaccgcaccatgcagctggccgtgctggtc
aatgactcggacttccagggcccgggggcgggcgtcgtcctgctccacttcaacgtgtca
gtgctgcccatcagcctgcacctgcccagtacctccttctccgtgagcaggagggctcac
cgatttgcccagatcgggaaagtctgtgtggaaaactgccaggcgttcagtggcatcaat
gtccagtatgagctccatgcctccggcgccaactgcagcactctaggggtggtcacctcg
gcggcggacacctcggggatcctgttcgtgaatgacaccaaagccctgcggcggcccaag
tgtgccgaactccagtacatggtggtggccacggaccagcagacctgcaggcaggcccag
gcccagctgctggtcacagtggtggggtcatacattactgaggaggtgggctgccccctg
tcctgtgcggtcagcaagagacggctggagtgtgaggagtgcggcggcctgggtgctctg
acgggcaggtgtgagtggaggcagggagacggcaaaggcatcaccaggaacttctccacc
tgctctcccagcaccaagacctgccctgacggccactgcgatgtggtggaggcccaagac
atcaacatctgcccccaggactgcctccgggtcagcattgtcggggggcatgaacctgga
gagccccgagggattaaagccggttacggcacctgcaactgcttccctgaggagaagaag
tgcttctgcgagccggaagacatccaggatccgctgtgtgacgagctgtgccgcacggtg
atcgcggctgctgtcctcttctccttcatcgtctcggtgctgctgtctgccttctgcatc
catcgctaccacaagtttgcccacaagccgcccgtctcctcagctgagatgaccttccgc
cggccagcccaggccttcccggtcagctactcttcatccggcgcccgccggccctcgctg
gactccatggagaaccaggtctccgtggacgccttcaagatcccggaggatccaaaatgg
gaattccctcgaaagaacttggttcttggaaaaactctaggagaaggtgaatttggaaaa
gtggtcaaggcgacggccttccgtctgaaaggcagagcagggtacaccacagtggccgtg
aagatgctgaaagagaacgcctccccaagtgagctgcgagacctgctgtcagagttcaac
ctcttgaagcaggtcaaccacccacatgtcatcaaactgtatggggcctgcagccaggac
ggcccgcttctcctcatcgtggagtacgccaagtacggctcccttcgaggcttcctccgc
gagagccgaaaggtggggcccggctacgtgggcagcggaggcagccgcaactccagctcc
ctggaccacccggacgagcgggccctcaccatgggcgacctcatctcgtttgcctggcag
atctcacgggggatgcagtacctggccgagatgaagctagtccatcgggacctggcagcc
agaaacatcctggtagctgaggggcggaagatgaagatttctgatttcgggctgtcccga
gatgtttatgaagaggactcctacgtgaagaggagcaagggtcggattccagttaaatgg
atggcaattgagtccctttttgatcatatttacaccacccaaagtgatgtgtggtctttt
ggtgtcctgctgtgggagatcgtgacccttggaggcaacccctatcctgggattcctcct
gagcggctcttcaaccttctgaagaccggccaccggatggagaggccagacaactgcagc
gaggagatgtaccgcctgatgctgcagtgctggaagcaggagccagacaaaaggccggtg
tttgcggacatcagcaaagacctggagaagatgatggttaagagcagagactacctggac
cttgcagcgtccactccatccgactccctgctttatgacgatggcctctcagaggaggag
atgcccctggtggactgtaataatgcccccctccctcgagccctcccttccacatggatt
gaaaacaaactctatggtagaatttcccatgcatttactagattctag

DBGET integrated database retrieval system